KEGG   Paenibacillus sp. JDR-2: Pjdr2_0476Help
Entry
Pjdr2_0476        CDS       T00977                                 

Definition
(GenBank) Glucan endo-1,6-beta-glucosidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00511  Other glycan degradation
pjd00600  Sphingolipid metabolism
pjd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Pjdr2_0476
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Pjdr2_0476
Enzymes [BR:pjd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Pjdr2_0476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydr_30_2 Glyco_hydro_59 ABC2_membrane_3
Motif
Other DBs
NCBI-ProteinID: ACS99156
JGI: Pjdr2_0476
UniProt: C6CSK7
Position
563488..564948
Genome map
AA seq 486 aa AA seqDB search
MRRFSTVILPVLLVALLATACSNGNSGRSGSADGQVQVWLTTPDKSKLLQQEESLKLTKA
KDSEENVITIDDRKVYQQMDGFGASMTDSSAWLIANKLNDSQREELMNKLFDHDKGIGIS
YMRVPLGASDFAVKNYTFDDMPAGQSDPELKNFSIDHDKEYIIPTLQQALKINPELKLMG
SPWSAPGWMKTTDSVIGGSLKPDAYEPFANYFVKMIQGYEAEGVPFDAITLQNEPHYTPD
DYPGMRMEPVEQAELIKNFVGPAFEKNSIKSKIVVWDHNWDEPYYPLTILNDPDASKYVD
GTAFHGYAGEVGNQAQVHDAHPDKNLYFTESSGGAWSTDFGGNLKWDMENLIIGATRNWS
KVVLKWNLALDENYGPTIGGCKDCMGVVTINQGSGDVAFNSEYYSFGHASKFVKSGAYRI
ESGESVSGEIEQVAFKNPDGTIVLVALNAASEDKELKVKLGGKSFAYTMPAGAVATFVWP
GTANSK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagaaggtttagcacggttatacttcccgtcttgctggtagctttgctggccacggcc
tgcagcaacgggaactcaggccgttcaggctctgccgacggacaggttcaggtttggctg
acgactccggacaagagcaagctgctgcagcaggaggaaagcctgaagctgacgaaggcc
aaggattccgaagagaatgtcattacgatcgatgaccggaaggtttatcagcaaatggat
ggctttggcgcttccatgacggattcctcggcttggcttattgcgaataagctgaacgat
tcgcagcgggaagagctgatgaacaagctgttcgaccatgataagggaattggcatcagc
tatatgcgcgtgccgcttggggcatcggattttgccgtaaagaactataccttcgacgat
atgccggccggtcaaagcgatccggagctgaaaaacttctctatcgatcacgataaggaa
tacatcattccgacgcttcaacaggcgcttaagattaacccggagctgaagctgatgggt
agtccgtggagcgctccgggctggatgaagacaaccgattccgtgatcggggggagcctg
aagcccgatgcttatgagccgtttgcgaattattttgtcaaaatgattcagggctacgaa
gcggaaggcgtaccgtttgatgcgattacccttcagaacgaaccgcattatacgccggat
gattatccgggcatgaggatggagccggtcgagcaggccgagctgatcaagaactttgtt
ggtcctgccttcgagaagaacagcatcaagtccaagatcgtcgtttgggatcataactgg
gatgagccgtattatccgctgaccattctgaacgatccggatgcctcgaaatacgtagac
ggaacagccttccacggttatgcgggagaggttggcaatcaggcgcaggtgcatgacgcg
catccggacaaaaatctctatttcacggaaagcagcggcggcgcttggtcaacggacttt
ggcggcaacctgaaatgggatatggaaaatctgattatcggcgcaacccgcaactggtcg
aaggtagtcttgaaatggaatctagcgctcgacgagaattatgggcccacgattggcggc
tgtaaggattgcatgggcgtcgtaacgattaatcaaggctccggcgatgtggcgtttaac
tcggaatactattcgtttggccatgcgagcaaattcgtgaaatccggtgcataccgcatt
gaatccggcgaatcggtgagcggggagatcgagcaggttgccttcaagaatccggacggc
acgatcgtactggttgcgctaaacgcggcaagcgaagacaaagaactgaaggttaagctc
ggcggcaaatcgtttgcttacacgatgccggcaggcgcggtggctacgtttgtatggccg
ggaacggctaacagcaaataa

DBGET integrated database retrieval system