KEGG   Paenibacillus sp. JDR-2: Pjdr2_0476Help
Entry
Pjdr2_0476        CDS       T00977                                 

Definition
glucan endo-1,6-beta-glucosidase (EC:3.2.1.75)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pjd00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:pjd00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
563488..564948
Genome map
AA seq 486 aa AA seqDB search
MRRFSTVILPVLLVALLATACSNGNSGRSGSADGQVQVWLTTPDKSKLLQQEESLKLTKA
KDSEENVITIDDRKVYQQMDGFGASMTDSSAWLIANKLNDSQREELMNKLFDHDKGIGIS
YMRVPLGASDFAVKNYTFDDMPAGQSDPELKNFSIDHDKEYIIPTLQQALKINPELKLMG
SPWSAPGWMKTTDSVIGGSLKPDAYEPFANYFVKMIQGYEAEGVPFDAITLQNEPHYTPD
DYPGMRMEPVEQAELIKNFVGPAFEKNSIKSKIVVWDHNWDEPYYPLTILNDPDASKYVD
GTAFHGYAGEVGNQAQVHDAHPDKNLYFTESSGGAWSTDFGGNLKWDMENLIIGATRNWS
KVVLKWNLALDENYGPTIGGCKDCMGVVTINQGSGDVAFNSEYYSFGHASKFVKSGAYRI
ESGESVSGEIEQVAFKNPDGTIVLVALNAASEDKELKVKLGGKSFAYTMPAGAVATFVWP
GTANSK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagaaggtttagcacggttatacttcccgtcttgctggtagctttgctggccacggcc
tgcagcaacgggaactcaggccgttcaggctctgccgacggacaggttcaggtttggctg
acgactccggacaagagcaagctgctgcagcaggaggaaagcctgaagctgacgaaggcc
aaggattccgaagagaatgtcattacgatcgatgaccggaaggtttatcagcaaatggat
ggctttggcgcttccatgacggattcctcggcttggcttattgcgaataagctgaacgat
tcgcagcgggaagagctgatgaacaagctgttcgaccatgataagggaattggcatcagc
tatatgcgcgtgccgcttggggcatcggattttgccgtaaagaactataccttcgacgat
atgccggccggtcaaagcgatccggagctgaaaaacttctctatcgatcacgataaggaa
tacatcattccgacgcttcaacaggcgcttaagattaacccggagctgaagctgatgggt
agtccgtggagcgctccgggctggatgaagacaaccgattccgtgatcggggggagcctg
aagcccgatgcttatgagccgtttgcgaattattttgtcaaaatgattcagggctacgaa
gcggaaggcgtaccgtttgatgcgattacccttcagaacgaaccgcattatacgccggat
gattatccgggcatgaggatggagccggtcgagcaggccgagctgatcaagaactttgtt
ggtcctgccttcgagaagaacagcatcaagtccaagatcgtcgtttgggatcataactgg
gatgagccgtattatccgctgaccattctgaacgatccggatgcctcgaaatacgtagac
ggaacagccttccacggttatgcgggagaggttggcaatcaggcgcaggtgcatgacgcg
catccggacaaaaatctctatttcacggaaagcagcggcggcgcttggtcaacggacttt
ggcggcaacctgaaatgggatatggaaaatctgattatcggcgcaacccgcaactggtcg
aaggtagtcttgaaatggaatctagcgctcgacgagaattatgggcccacgattggcggc
tgtaaggattgcatgggcgtcgtaacgattaatcaaggctccggcgatgtggcgtttaac
tcggaatactattcgtttggccatgcgagcaaattcgtgaaatccggtgcataccgcatt
gaatccggcgaatcggtgagcggggagatcgagcaggttgccttcaagaatccggacggc
acgatcgtactggttgcgctaaacgcggcaagcgaagacaaagaactgaaggttaagctc
ggcggcaaatcgtttgcttacacgatgccggcaggcgcggtggctacgtttgtatggccg
ggaacggctaacagcaaataa

DBGET integrated database retrieval system