KEGG   Paenibacillus sp. JDR-2: Pjdr2_0787Help
Entry
Pjdr2_0787        CDS       T00977                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pjdr2_0787
   00052 Galactose metabolism
    Pjdr2_0787
   00500 Starch and sucrose metabolism
    Pjdr2_0787
   00520 Amino sugar and nucleotide sugar metabolism
    Pjdr2_0787
Enzymes [BR:pjd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Pjdr2_0787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
916885..917793
Genome map
AA seq 302 aa AA seqDB search
MKQERVTAMFHEKKRQQVRKAIIPAGGLGTRFLPATKAQPKEMLPIIDKPAIQYIVEEAV
QSGIDSIIIVSGRHKRAIEDHFDKSYELEKELEERGNEEMLAIVRDISHLADIYYVRQKE
PLGLGHAVLCARRFIGDEPFAVLLGDDILRSEPPCLQQMIHQYEETGSSVVALMEVPWNQ
THKYGIAAFDNADPSRNRILDLIEKPAPGQAPSNWAVVGRYVLDPAIFELLEHARPGKAG
EIQLTDSLQQLNHFAPILAHRFTGKRHDVGDKLGFVKATIDFALEREDLSEEVRKYLRER
LG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaagaaagggtgacggccatgtttcatgagaagaagaggcagcaggtacgcaaa
gccattattccggcagggggactcggtacgcgattcctgcccgctaccaaggcgcagccg
aaggaaatgcttccgattatcgataagccggctattcaatatattgtagaagaagcggtg
cagtccggcatcgacagcatcattatcgtcagcgggaggcataagcgggcgatcgaggac
cattttgacaaatcttatgaattggaaaaagaactcgaggaacgcggcaacgaagagatg
ctcgccatcgtccgggatatctcgcatctggccgatatctattacgtccgtcagaaggag
ccgcttgggcttggacatgctgttctatgcgcgcggcgttttatcggggacgagccgttt
gcggtgctgcttggcgatgacatcctgcgttccgagccgccatgcctgcagcagatgatc
catcagtacgaggagacgggctcctcggttgtcgccctgatggaagtgccttggaatcag
acgcataaatacggcatcgctgcttttgataacgctgatccttcccgtaaccgcattctt
gacctgatcgaaaagcctgcgccagggcaggcgccatccaattgggcggtcgttgggcgg
tatgtgctggatccggcgatcttcgagctgctggagcatgctaggcccggcaaggccggg
gaaattcagctgacggacagccttcagcagctgaatcatttcgctccgattctggcgcat
cgcttcacgggcaaacgccatgacgtgggcgataagctgggcttcgtgaaagcgacgatt
gatttcgccctggagcgggaggatctgtcggaggaagtccgcaaatatttgcgcgagcgc
ctcggctaa

DBGET integrated database retrieval system