KEGG   Paenibacillus sp. JDR-2: Pjdr2_0808Help
Entry
Pjdr2_0808        CDS       T00977                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00790  Folate biosynthesis
pjd01100  Metabolic pathways
Module
pjd_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pjdr2_0808
Enzymes [BR:pjd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Pjdr2_0808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF DUF3638
Motif
Other DBs
NCBI-ProteinID: ACS99487
JGI: Pjdr2_0808
UniProt: C6CUX3
Position
937025..937615
Genome map
AA seq 196 aa AA seqDB search
MAGMKDYVNSAVSRNRDQIEHHIKEILKLVGEDVEREGLLETPARVTRMYEEIFAGYEVD
PREVLGVTFDERHEELVIVKDIVYYSQCEHHMAPFFGKAHIGYIPSGKIAGLSKLARLVE
AVSRRLQVQERITTQIADIMQEVLKPQGVMVVVEGEHLCMCARGVKKPGSKTVTSAVRGV
FSDSALRSEFLSLLKQ
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaatgaaagactacgtcaattcggcggtatcgcgcaaccgggatcaaattgag
caccatataaaagaaattttgaagctggttggcgaagacgtcgaaagagaagggctgctg
gagacaccagctcgcgttacccggatgtatgaagagattttcgcgggctacgaggtagat
ccgcgcgaagtgctgggcgttacctttgacgagcggcatgaagagcttgttattgtcaaa
gacattgtctattacagccaatgcgagcatcatatggcgccgttcttcgggaaagcgcat
atcggctatattccaagcggcaaaattgccggtctcagcaagcttgcaagactggttgaa
gcggtatcgagaagactgcaggtgcaggagcggattacgacgcagatcgcggacattatg
caagaagtgctgaagccgcaaggcgtgatggttgtcgttgaaggcgagcatctgtgcatg
tgcgcgcgcggcgtgaagaagccgggcagcaagacggttacgtcggcggttcgtggcgtg
ttctcggacagtgctcttcgttcggagtttctgtctttgctcaagcaatag

DBGET integrated database retrieval system