KEGG   Paenibacillus sp. JDR-2: Pjdr2_0808Help
Entry
Pjdr2_0808        CDS       T00977                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pjd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
937025..937615
Genome map
AA seq 196 aa AA seqDB search
MAGMKDYVNSAVSRNRDQIEHHIKEILKLVGEDVEREGLLETPARVTRMYEEIFAGYEVD
PREVLGVTFDERHEELVIVKDIVYYSQCEHHMAPFFGKAHIGYIPSGKIAGLSKLARLVE
AVSRRLQVQERITTQIADIMQEVLKPQGVMVVVEGEHLCMCARGVKKPGSKTVTSAVRGV
FSDSALRSEFLSLLKQ
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaatgaaagactacgtcaattcggcggtatcgcgcaaccgggatcaaattgag
caccatataaaagaaattttgaagctggttggcgaagacgtcgaaagagaagggctgctg
gagacaccagctcgcgttacccggatgtatgaagagattttcgcgggctacgaggtagat
ccgcgcgaagtgctgggcgttacctttgacgagcggcatgaagagcttgttattgtcaaa
gacattgtctattacagccaatgcgagcatcatatggcgccgttcttcgggaaagcgcat
atcggctatattccaagcggcaaaattgccggtctcagcaagcttgcaagactggttgaa
gcggtatcgagaagactgcaggtgcaggagcggattacgacgcagatcgcggacattatg
caagaagtgctgaagccgcaaggcgtgatggttgtcgttgaaggcgagcatctgtgcatg
tgcgcgcgcggcgtgaagaagccgggcagcaagacggttacgtcggcggttcgtggcgtg
ttctcggacagtgctcttcgttcggagtttctgtctttgctcaagcaatag

DBGET integrated database retrieval system