KEGG   Paenibacillus sp. JDR-2: Pjdr2_0813Help
Entry
Pjdr2_0813        CDS       T00977                                 

Definition
D-alanine--D-alanine ligase (EC:6.3.2.4)
Orthology
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of other amino acids; D-Alanine metabolism [PATH:pjd00473]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pjd00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
944373..945500
Genome map
AA seq 375 aa AA seqDB search
MGQKVHLGLIYGGKSGEHDVSLRTAFAVMGELDYAKYEITPFYITRLGEWRVGSMLGGQP
GAIDELRLAPVDGAPVPIVPDLPLAPLLDRLAGGALPGGGQPIDVVFPLLHGTFGEDGTI
QGLLEIADIPYVGAGVLASAAGMDKITMKKIFAYEGLPQCVFRYFNRAQWEKDASFFIME
CEVALGYPCFVKPSNLGSSVGISKAKNRDELIAAIDFAFRFDRRVIVEEFVDAREIEVSV
LGNDDPKISVPGEIAPSNEFYDYKAKYVDGKSTIHIPANIPNKTADAVRDMALRAFLAID
GAGLSRVDFFLRKTDGQLFINEVNTMPGFTPISMYPLMWKESGLPYKDLLDKLIDLAFKR
YADRRTIDYGSSGGN
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggggcagaaagtacacttagggttgatttacggagggaagtcgggagagcatgacgtg
tcgctgcggacggcgtttgcggtgatgggggagcttgattacgcaaaatatgaaataacg
cctttttatattaccaggctaggcgaatggagagtgggctcgatgcttggcgggcagccg
ggagcaattgacgagctgcgccttgcgccggtggacggggcaccggtgcctattgtaccg
gatctaccgcttgcccctctcctcgaccgcttagccggcggtgcgctgccaggcgggggg
cagccgatcgatgttgttttcccgctgctccacggtaccttcggagaagacggtacgatt
cagggcctgctcgaaattgcggacatcccttatgtcggggcgggggttctagcctccgct
gcagggatggacaagattacgatgaagaagatattcgcctacgagggtctgccgcaatgc
gtcttccggtatttcaatcgggcgcagtgggagaaggacgcctccttttttattatggaa
tgcgaagtcgccttgggttacccgtgtttcgtaaagccgtccaaccttggatcaagcgtc
ggcatatccaaagctaagaaccgcgacgagctgattgcggccatcgattttgccttccgg
ttcgaccgcagggtaatcgtggaggagttcgtcgatgccagggagatcgaagtcagcgtt
cttggcaatgacgatccgaagatatccgtgcccggggaaattgctccgtccaacgagttt
tacgactacaaggcgaagtatgtggacggcaaatccaccattcatattccggcgaatatt
ccgaacaagacggcggatgcagtccgggatatggcgctgcgggcttttctggcgattgac
ggggcggggctgtcgcgggtagacttcttccttcgcaagacggacggccagctgttcatt
aacgaagtgaacacgatgccgggctttacgccaatcagcatgtacccgcttatgtggaag
gagtcgggcctgccctacaaggatttgctggataagctgatcgacctggcgttcaagcgt
tatgccgatagacggacgattgattacggaagcagcggcggcaactaa

DBGET integrated database retrieval system