KEGG   Paenibacillus sp. JDR-2: Pjdr2_0896Help
Entry
Pjdr2_0896        CDS       T00977                                 

Definition
(GenBank) Beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Pjdr2_0896
Enzymes [BR:pjd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Pjdr2_0896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_35 Cellulase Glyco_hydro_42C Glyco_hydro_2_C
Motif
Other DBs
NCBI-ProteinID: ACS99575
JGI: Pjdr2_0896
UniProt: C6CV62
Position
1066126..1068132
Genome map
AA seq 668 aa AA seqDB search
MNKLFYGVAYYDEYMPYERLSTDIEMMKEAGINLVRIAESTWSTHEPQNGVFDFSSVDRV
LDAMHEAGIHVIVGTPTYAVPTWMVKEHPDVLAETPDGPGRYGARQIMDITNPSYLFYSE
RIIRKLISRVCGHPAVIGYQVDNETKHYRTSGPNVQLRFVKYMREKFGTVERLNEEFGLD
YWSNRINSWEDFPSAVGTINGSLGAEFARFQRQLVTDFLAWQASIVNEYKRPGQFVTHNF
DFEWRGYSFGVQPDVDHFEAAKALDIAGVDIYHPSQDDLTGKEISFGGDSTRSLKGMNYF
VLETQAQAFPNWTPYPGQLLQQAFSHLASGANMVEYWHWHSIHNSFETYWKGLLSHDLGP
NPTYNEARIVGRQFARLSDKLVNLKKTNRAAVLVSNEALTSLDWFKLPGGEVRYNDIVRL
MYDRLYEMNIGCDILHPGSIELLGNYDLIVVPALYAASGELLEALNRYVENGGHVVYTFK
SGFANEHIKVRTGAQPGLIEKACGIRYSQFAEPSKVSLKGNPFGVGESDNNVEVWMELLT
PTTAEVLAWYDHPHWGQYAAITTNRHGEGVATYIGCLPSEAAARKVLEGACREAGIWGVD
QELQFPVIVKTGTNESGKTIRYYFNYSDEPQSFVYPHGDGAELLGDLGLRSGETIELERW
GVAIVEEA
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaagctgttctatggagtagcctattacgacgagtatatgccttacgaaagatta
agcacggatattgagatgatgaaggaagcggggattaatctggtccgcatcgcggaatcg
acctggagcacgcatgagccgcaaaacggcgtatttgatttctccagcgtggaccgcgtg
ctggatgccatgcatgaagcgggtattcacgtgattgtcggaacgccaacctacgcggtg
cccacctggatggtgaaggaacatccggacgtactggctgagacgccggacggaccgggc
cgctacggggcgcggcagattatggacattacgaacccttcgtatttgttttattccgag
cgtattatccgcaagctgatcagccgggtatgcgggcatcccgccgttatcggttatcag
gtagataacgaaacaaagcattaccggacaagcggtcctaacgtacagcttcgcttcgtt
aagtatatgagggagaagttcggtacggtagagcggctgaacgaggaatttggcctcgat
tactggagcaaccggattaacagctgggaggacttcccgtcggctgtaggtacgatcaac
ggaagccttggagcggagttcgcaagattccagcggcagctcgtgaccgatttcctcgcg
tggcaggcatccattgtgaacgagtataaacgtccgggtcaattcgttacgcataacttt
gattttgaatggcggggttattcctttggcgttcagccggacgtggaccatttcgaagcg
gcgaaggcgctcgacatcgcgggcgttgatatttatcatccgtcgcaggatgatctcacc
gggaaggaaatttccttcggcggagactcgacccgatcgctgaaagggatgaactatttc
gtgctggagacgcaagcccaagcgttcccgaactggacgccttatccgggccagctgctg
cagcaggcattcagccacttggcttccggcgctaatatggtcgaatattggcattggcat
tccattcataactctttcgaaacgtattggaaaggcctgctcagccatgacttggggcca
aatccgacttataacgaagccaggattgttggccgccaattcgcccgtttgtcggacaag
ctggttaacctcaagaagacgaaccgcgctgccgtcctagtgagcaacgaagcgttgacg
tctctcgactggtttaagctgcctggcggagaggtccgttacaatgatatcgtccgtctc
atgtacgaccggctgtacgagatgaatatcggctgcgatattttgcatccggggtctatc
gagctgctgggcaattacgatttgatcgttgtgccggcgttgtacgctgcatcaggcgag
cttcttgaggctttgaaccgctacgtcgagaacggcggccatgtcgtatatacgttcaag
agcggttttgcgaacgagcatattaaggtgcggacgggcgctcagccaggcctcatcgag
aaagcttgcggcattcgttattcgcaatttgcggagcctagcaaggtgtcgctgaaaggg
aatccgtttggcgttggggagtctgacaataacgttgaggtatggatggagctgcttacg
ccaactacggcggaggtgcttgcttggtacgatcatccgcattggggacaatacgcggcg
atcacgaccaaccggcatggcgaaggcgtcgcaacctatatcggctgcctgccaagcgaa
gcggctgcccgcaaagtgctggagggagcatgccgcgaagcgggaatttggggagtcgac
caggagcttcagttcccggttatcgttaagacggggactaacgagtccggcaaaacaatc
cgctattatttcaattattcggatgaaccgcaatccttcgtctatcctcatggagacggc
gccgagctgctcggtgacctcgggctccgctcgggtgaaacgattgagcttgagcgttgg
ggcgtagcgatagtagaggaagcttaa

DBGET integrated database retrieval system