KEGG   Paenibacillus sp. JDR-2: Pjdr2_1027Help
Entry
Pjdr2_1027        CDS       T00977                                 

Definition
ABC transporter
Orthology
K01990  
ABC-2 type transport system ATP-binding protein
Organism
pjd  Paenibacillus sp. JDR-2
Module
ABC-2 type transport system
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1240360..1241088
Genome map
AA seq 242 aa AA seqDB search
MNLETVIQVSSIRKCYGPYNALNEVSFEVNRGELFGIIGTSGAGKTTLLEMLMGLRRPDQ
GTIEVLGMDAIMEAKQLKEYIGMHMYSNSLVDNLTVREALELFQSFYIKQNDIDRIIADL
ELEPYVNKPVKRLSGGWQQRIALAFALVNDPEIIFLDEPTTGLDKQARADYWALLMKLKS
QGKTIVMASHDMGEMQRNCDRIAVLRKGDIVRCDSPQQLISQIPEGCFSMEGVYVHFAYA
GM
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
gtgaacttagagacggtcattcaagtaagctcgattcgcaaatgttatggtccgtacaac
gctttaaatgaagtctcctttgaagtgaacagaggcgagctgtttggcattatcgggaca
agcggggcaggcaaaacaaccctgctggagatgctcatgggacttcgccgacctgatcag
ggaacgattgaagtactcggcatggatgccattatggaagccaagcagctgaaggaatat
atcggaatgcatatgtacagcaactcgctcgtagacaatctaacggttcgtgaagcgctg
gaattgttccaatcgttttacatcaaacaaaatgacatcgatcggattattgcggatctg
gagctggagccgtacgtaaacaagccggtgaaacggctgtccggcggctggcagcagcgc
atcgcgcttgctttcgcgctggtgaacgatcctgaaatcatattcctcgatgagccgaca
accgggcttgataagcaggcgagggcggattactgggctctgcttatgaagttgaagagt
caaggcaaaacgatcgttatggcatcccatgacatgggagaaatgcagcggaattgcgat
cgcattgcggtgctgcgcaaaggggatatcgtcagatgcgattctccgcagcagctcatc
tcccaaattccagaaggctgtttttcgatggaaggcgtatacgttcatttcgcttacgcg
ggaatgtag

DBGET integrated database retrieval system