KEGG   Paenibacillus sp. JDR-2: Pjdr2_1165Help
Entry
Pjdr2_1165        CDS       T00977                                 

Definition
(GenBank) Beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Pjdr2_1165
Enzymes [BR:pjd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Pjdr2_1165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5 Cellulase
Motif
Other DBs
NCBI-ProteinID: ACS99842
JGI: Pjdr2_1165
UniProt: C6CVX8
Position
1394244..1395998
Genome map
AA seq 584 aa AA seqDB search
MSPLTIQGKQLMLNDRPFRIIAGAIHYFRVVPEYWRDRLLKLKACGFNTVETYVPWNFHE
PEEGRFVFEGMADLEKFIALAGELGLYAIVRPSPYICAEWEFGGLPAWLLKDPGMRLRCS
YKPFLDKADAYYDELIPRLTPFLSTKGGPLIAMQIENEYGSYGNDKTYLNYLKEALVKRG
VDVLLFTSDGPEDFMLQGGMVEGVWETVNFGSRSAEAFAKLQEYQPDQPLMCMEFWNGWF
DHWGETHHTRGAADVALVLDEMLAAGASVNFYMFHGGTNFGFFSGANYTDRLLPTVTSYD
YDSPLSESGELTEKYYAVREVIAKYAELGPLELPAQIVAKSFGSVRMTGQARLLASLDEL
SVPIPSVCPEPMEQYGQNSGFILYATHLTGPRPASRLNLQEVHDRALIFIDGVFKGVIER
SNPEHDLVFDVPPGGVELAILVENMGRINYGPHMKDVKGITEGVRFGQQFLFNWTVRPLP
LDDLSKLQFSALSSQPCLQPSFYRGEFEVDEPADTFLSMKGWTKGVAYMNGFNLGRYWEI
APQETLYIPGPLLRTGKNEIIVFELHAAESASVSLLDCPVLNKQ
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgagtccactgactattcaaggcaaacaattaatgctgaacgatcgtccgtttcgaatt
atagccggcgccatccattattttcgcgttgttccggagtactggcgcgaccgcctgctt
aaattgaaggcatgcgggtttaatacggttgaaacttacgtgccgtggaatttccatgag
ccggaggaaggccgctttgtattcgagggcatggcggatctggagaagttcatcgcgctt
gccggcgaactgggattgtacgcgattgttcgtccaagcccgtacatttgcgcggagtgg
gagtttggcggattgccggcatggctgctcaaagaccccggcatgcgcctgcgctgcagc
tataagccgttcctggacaaagcggatgcttattacgacgaactgatcccgcgcctgacc
ccgttcctgtccaccaagggcggtccgctcatcgcgatgcagatcgagaacgagtacggc
agctacggcaacgataaaacgtatctcaactacctgaaggaagcactcgtcaaacgcggc
gtggatgtactgctatttacctctgacggaccggaagattttatgctgcaaggcggcatg
gttgaaggcgtatgggaaacggttaatttcggatcccgttcggctgaggcattcgccaag
ctgcaggaatatcagccggatcagccgcttatgtgcatggaattttggaacggctggttc
gaccactggggggagactcatcatacccgcggcgccgcggatgttgccctggtgcttgac
gagatgctggcagccggtgcttcggtcaatttctatatgttccatggggggaccaacttc
ggctttttcagcggagcgaactacacggacagactgcttccgacggttacgagctacgac
tacgattcgccgcttagcgagagcggggaattgacggagaaatattatgccgttcgcgaa
gtcattgccaagtatgcggagctcggaccgcttgagctgccggcgcaaatcgtggcaaaa
agcttcggtagcgtgcgtatgactggccaagctcggctgctcgcttcgcttgatgagttg
tccgtaccgattccaagcgtgtgcccggagccgatggagcagtatggccaaaactcgggg
tttatcctgtacgcgacgcatttaaccggcccgcgtccggcaagccgcctcaacctgcag
gaggttcatgaccgcgcgcttatctttattgacggcgtgttcaaaggcgttattgaacgc
tccaacccggagcatgatctcgtatttgacgtaccgcccggcggcgtggagctggccatt
ctcgtcgagaatatgggacggatcaattacggtccgcacatgaaggatgttaagggaatt
accgaaggcgtacgtttcggacagcagttcctgtttaattggacggtgcgcccgttgccg
ctggatgacctgtccaaactgcaattttctgctttaagcagtcaaccgtgccttcagccg
tccttctatcggggcgagttcgaagtggatgagccggccgacacgttcctaagcatgaaa
gggtggaccaagggtgttgcctatatgaacggctttaatctgggtcgttattgggagatt
gcgcctcaagaaacgttgtacattccggggccgctgctccgcacgggcaaaaacgagatc
atcgtattcgagctgcacgcagcggagtccgcaagcgttagcctgctggactgcccggta
ttaaataagcaataa

DBGET integrated database retrieval system