KEGG   Paenibacillus sp. JDR-2: Pjdr2_1278Help
Entry
Pjdr2_1278        CDS       T00977                                 

Definition
deoxynucleoside kinase
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Pjdr2_1278
   00240 Pyrimidine metabolism
    Pjdr2_1278
Enzymes [BR:pjd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     Pjdr2_1278
    2.7.1.76  2'-deoxyadenosine kinase
     Pjdr2_1278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1523423..1524097
Genome map
AA seq 224 aa AA seqDB search
MEHVIPSNALITIAGTVGVGKSTLTSALAERLGFRTSLEQVEHNPYLEKFYHDFERWSFH
LQIYFLAERFKEQKAIFEAGGGFVQDRSIYEDTGIFAKMHADQGTMTATDYATYTSLFEA
MVMTPYFPHPDVLIYLEGSLPSIVNRITARGREMEIQTERAYWERMHERYAAWIGEFNAC
PVLRLNIDEYDVHDPASLEGIIAQISSVIGASRLAKAQAAAASE
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggaacatgtcattccttctaatgcgcttattacgatagccggtacggttggagtcggc
aaatcgacgttaacgtctgctttggccgagcgtcttggcttccggacttcgctggagcag
gtcgagcataacccgtatctggagaagttttaccatgatttcgagcggtggagcttccat
ttgcaaatctattttctggccgagcgctttaaagagcagaaggcgatttttgaggcgggc
ggaggatttgtgcaggaccgttccatttacgaggataccggcatctttgcgaaaatgcat
gcggatcagggaacgatgaccgcaacggattatgcgacttatacaagcttgttcgaagcg
atggttatgacgccgtattttccgcatccggatgttctgatttatttggaaggtagcctg
ccgtccattgtgaaccggattacggcgcgcgggcgggagatggaaatccagacggaacgc
gcttattgggagcggatgcatgaacgttatgcagcttggattggcgagtttaacgcttgt
ccggtgcttaggctgaacattgacgagtatgatgttcacgatccggcatcgctggaagga
attatcgcgcaaatcagcagcgtaattggggcgtcgaggctggcaaaggcacaggcggct
gctgcaagcgaatag

DBGET integrated database retrieval system