KEGG   Paenibacillus sp. JDR-2: Pjdr2_1460Help
Entry
Pjdr2_1460        CDS       T00977                                 

Definition
(GenBank) Beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00520  Amino sugar and nucleotide sugar metabolism
pjd01100  Metabolic pathways
pjd01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Pjdr2_1460
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Pjdr2_1460
Enzymes [BR:pjd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Pjdr2_1460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Exonuc_VII_S
Motif
Other DBs
NCBI-ProteinID: ACT00135
JGI: Pjdr2_1460
UniProt: C6CWS0
Position
1746575..1748182
Genome map
AA seq 535 aa AA seqDB search
MGEYNGNSWSLREKVGQLFVFGFHGYEPTEEITSLIEKYGIGGTIYFGRNVRDAKQVHQL
SSSLKNIAGRAGRPNMLVAIDQEGGMVARIVNGVTLMPGNMALGATGSAEGAGETARVCG
EELRLLGVTMNYAPCLDVNNNPDNPVINVRSYGDRAQIVSELGKAALLGYQASKVAATVK
HFPGHGDTSVDSHHDLPVLPHSRERLDAIELAPFRAAIAAGTAAIMTAHVCLPALDPSGK
PSTLSQPVLTGLLREELGYNGVIVTDCLEMDAIDRFYGPANGAVQAIQAGADMILVSHTY
EKQVAALEAVVAAVENGELSEERINESLARVMQLKQDYEIEMPLAAWEEVEPKLATSGNQ
AVARKWSEASATLVKNEGALLPLRREARTLVLWPDIKPVSVADEMLSGDGTLGDCLKVRL
DQVEERLMRGENPLADLDAFEQIVVVTYDATKHPIEREIAEQVIRLAGDRTVAVSVRNPL
DLKVYPDAKAYLAVYECRPLALESAAKVLTGELKPTGSLPLELSAQYPFGWNVPL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgggagaatataatgggaacagctggtcgctaagggagaaggtcggacagctgtttgta
ttcggatttcacggctatgaacctacggaagagatcacttcgttaatcgaaaagtatggc
atcggcggcacaatctatttcggacgaaatgtgcgcgatgccaagcaggttcatcagctg
tccagctcgctgaagaacattgccggtcgtgccggccggcccaatatgcttgtcgcgatt
gatcaggaaggcggcatggtggcccgcattgtgaacggggtcacgctgatgcccggcaat
atggcgcttggagcaacgggttcggctgagggagcgggcgagacagcccgcgtatgcggc
gaggagcttcgcttgctaggcgttacgatgaactatgcgccatgtctcgacgttaataat
aacccggataatccggttattaatgtccgttcctatggcgaccgggcgcaaattgtcagt
gagctggggaaagctgccctgctgggctatcaggcgtcaaaggtagcggcaacggtaaaa
catttcccgggccacggcgatacctcggtagactcccatcatgatttgccggtgctgcct
catagccgggagcggctggatgcaatcgagctggcaccgttccgtgcggcaattgcggct
ggaacggcggctattatgacggcgcatgtctgcctgccggcgctcgacccatcagggaag
ccttcgactttgtctcagccggttttaaccggtctgctgcgtgaagaactaggctacaat
ggggttatcgtcaccgattgtctcgagatggatgccatcgatagattttacggtccggcg
aatggcgcggtacaggccattcaagccggagcggacatgattctcgtcagccatacgtat
gaaaagcaggtggctgcgcttgaagccgtggtggctgcggtcgagaacggcgagttgtcc
gaggagcggattaacgaatcgctcgccagagtaatgcagctgaaacaagattatgagatc
gaaatgcctcttgcggcttgggaggaggttgagccaaagcttgcaacctccggcaaccaa
gcggttgcacggaagtggagcgaagcctctgctactctagtaaaaaatgaaggcgcgctg
cttccgctgcgccgggaagcccgtactctcgtgttgtggccggatatcaaaccggtatcc
gttgcggatgagatgttatcgggagacggtacgcttggcgattgtctgaaagttcggctt
gatcaggttgaggagcgtttgatgagaggcgaaaatcctcttgcggatctggatgcattc
gagcagattgttgtggttacttacgatgcgacaaaacatccgattgagcgcgagatcgcc
gagcaagtcataaggctggcaggcgaccgcacggttgcagtgtctgtccgcaacccgctt
gatctgaaggtatatccggatgcgaaagcctatctggccgtatacgaatgccgtccgctt
gctctggaatcagccgccaaggtattaaccggcgagttgaagccaaccggctcgctgccg
cttgagctatctgcgcagtacccgtttggatggaatgtaccgctgtaa

DBGET integrated database retrieval system