KEGG   Paenibacillus sp. JDR-2: Pjdr2_1509Help
Entry
Pjdr2_1509        CDS       T00977                                 

Definition
glycoside hydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pjdr2_1509
Enzymes [BR:pjd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Pjdr2_1509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1800486..1802105
Genome map
AA seq 539 aa AA seqDB search
MEQGKRNRIAVNQLGFRRMDRKTAVIEGEGGTFRLISQETGEVVLEGETGTAAGDRSSGR
KVSRADFSGVQQAGIYKLETEHGQVSDWFAIGDEGYRAAHQALLKAFYYFRCGIKLEESY
AGAWKHDACHLTPAIVYGDESRNVDAWGGWHDAGDYGKYVGPGAKAVADLLLAYECYPDA
FARVLPLPESDGVMPDVLHECRYELEWMQRMQDAESGGVFHKLTTMRFPAPDTMPEDDTD
ELYVSPVSATATGCFAAIMAMAARVYGRFDAGLAAGCKAAAERAWDWLERHPEVPGFRNP
PEIVTGEYGDKLDIDERYWAAAELYRTTGEERYHEAFLLLAEREFDKYELGWADMGGYGT
ISYLLSERRGDLAVTERLRAGLLERAERLADVSRKDGFGVSLQPEQYKWGSNMLVLNHAM
LLLIADRVAGTVTYADLALNHIHYLFGMNVMGISYVTGFGSRSVKHPHHRPSEGDGVDDP
VPGLVSGGPNLGIQDDYAREHLAGRAPAASFADVMESYSTNEVTIYWNSPAVFVLSHFV
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggggaagcggaataggattgcggttaaccagcttgggttccggagaatggac
cggaagacggctgttatagaaggagaaggcggaacgttcaggttgattagtcaggaaacc
ggcgaagtggtgttggagggggaaaccgggactgcagctggggacagatccagcggcagg
aaagttagcagggcggatttttccggcgtgcagcaagccgggatttacaagctggagacg
gagcatgggcaagtctcggattggtttgctatcggagatgagggatatagggctgctcat
caggcattgttgaaagcgttttattatttccgctgcggaatcaaactggaggagtcgtac
gcgggagcgtggaagcatgatgcttgccatctgacgcctgcgattgtatacggagacgaa
tcgaggaatgtggatgcctggggcggatggcatgatgccggcgactatggcaaatacgtg
gggccgggagcaaaagccgttgcggatttgctgcttgcttatgaatgttatccggatgcg
tttgcgcgtgtgctgcctttgcctgaatcagacggcgtgatgccggatgtgctccatgaa
tgccggtatgagctggaatggatgcaacgcatgcaggatgcggagtccggcggcgtgttc
cataagctgacgactatgcgtttccctgctccggatacaatgccggaggacgatacggac
gagctgtacgtttctccggtatcggccacggcaacgggttgttttgccgccattatggcg
atggctgcgcgcgtgtacgggcgttttgatgcagggcttgccgccggttgcaaagctgcc
gccgagcgggcatgggattggcttgagcggcatccggaagtaccgggcttccgtaatccg
ccggagattgtaaccggtgaatatggcgataagctggacattgatgagcggtattgggca
gcagccgagctgtatcgtacaacgggagaagagcggtatcacgaggcttttctcctgttg
gcggagcgggaattcgacaagtacgaacttggctgggccgatatgggcggctacgggaca
atctcctatctgttgtcggaacgtcggggggatctggctgttacagaacggcttcgggcc
ggtctgttggaacgagccgagcggcttgctgatgtaagccggaaggatggattcggcgta
tctttacagccggagcagtacaaatggggcagcaatatgctggtactcaatcatgcgatg
ctgctgctaattgctgatcgcgtggctggaacagttacgtatgcggatctggcgttgaat
catatccattacctattcgggatgaatgtgatgggcatcagttatgtaacggggttcggc
agccggtcggtcaaacatccgcatcatcgtccatcggaaggcgacggcgtggacgatccg
gttccggggcttgtatccggcggtccaaaccttggcattcaggatgactatgcccgggag
catctggctggcagagccccagccgcttccttcgcggatgtgatggaaagctactcgaca
aacgaagtaacgatctactggaattctcctgccgtgtttgtgttgagtcattttgtatag

DBGET integrated database retrieval system