KEGG   Paenibacillus sp. JDR-2: Pjdr2_1524Help
Entry
Pjdr2_1524        CDS       T00977                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:pjd03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1822636..1823499
Genome map
AA seq 287 aa AA seqDB search
MPELPEVETVRRTLIELVAGKRIASVEVKLPRIIQRPAEPEAFEMALAGRTIQTVERRGK
FLRVVMDGLVLVSHLRMEGRYGVFPSDEPVELHTHVLFHFDDGTDLRYKDVRQFGTMHLF
EPGTEFEMKPLSKLGLEPLENEAFTADALKGLLGKKTGLIKPLLLNQEYVVGLGNIYVDE
ALFLAGIHPERTADSLKKAEWIRLHEAIVSTLAKAVAAGGSSIKSYVNGQGEMGMFQHQL
LVYGRKDEPCASCGRLIEKSVVGGRGTHTCASCQPLPKARKKAVPQV
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaattgccagaggtagaaacggtaagaagaacattaattgaattagtcgcaggc
aagcgaattgcttcggtagaagtgaagctgccgcgtatcatacaacgcccggctgaaccg
gaggcgttcgaaatggcgcttgccggacggacgatccaaacggttgagcgccgcggaaag
tttttgagagtagtcatggacggtcttgtgctggtctcccatcttcggatggaaggacgc
tacggcgtatttccaagcgacgagcctgtcgagcttcatacgcatgtcctgttccacttc
gatgacggaacggatctgagatataaggatgtacgtcaattcggcaccatgcatctgttc
gagccggggacggaattcgagatgaagccgctaagcaagcttggcctcgagccgctggag
aatgaggcttttacagcggatgccttgaaaggattgcttgggaaaaaaacaggtttaatc
aagccgcttctgttaaatcaggaatatgtcgtggggcttggcaatatttatgtggatgag
gctttattcttagcgggcattcatccggagcggacagcggattccttgaagaaagcggaa
tggatccgtctgcatgaggccattgtatcgacgcttgcgaaggctgtagcggcaggaggc
tcttccattaaatcctacgtaaacggacaaggcgaaatggggatgttccagcaccagctg
ctggtgtacgggaggaaagacgagccttgcgcaagctgcggcagattaatcgagaaatcg
gttgtaggcggaagaggaacgcatacctgcgcgagctgccagcctttgccaaaggcacgc
aaaaaggctgtcccgcaggtttaa

DBGET integrated database retrieval system