KEGG   Paenibacillus sp. JDR-2: Pjdr2_1747Help
Entry
Pjdr2_1747        CDS       T00977                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pjd00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2059335..2061392
Genome map
AA seq 685 aa AA seqDB search
MINAKKPKIWYGGDYNPDQWEKEVWDEDLRMFKLSGIDVATLNVFAWAKNQPDEDTYDFG
WLDEMMDKLHADGVGVCLATSTAAHPAWMARKYPDVLQVDFNGNKRKFGGRHNSCPNSPT
FRKYSVRMAEKLAERYKDHPALLIWHINNEYGGAGNCYCDNCEAAFRVWLKDRYGTIEEV
NKAWNTAFWGHIFYDFEDIVLPSGRSEEWYGANGRTETNFQGLSLDYMRFHSDSLLECYK
LEYEAVKKVTPDIPVTTNLMGAFKKLDYHKWAKHMDVVSWDNYPRFDTPHSYTGMMHDLM
RGLKDGQPFMLMEQTPSQQNWQPYNSLKRPGVMRLWSYQAVARGADTILFFQLRRSTGAC
EKYHGAVIEHVGHEHTRVFRECAELGAELGKLGDTLLDARVKAKVAILFDWENWWAIEMS
SGPSIALKYVNEAHKFYDALYRAGIAADVVSVEADLSGYDLVIAPVMYMVKDGVAEKLEA
YTAAGGAVITTYFSGIVNETDLVTLGGYPGKLRKLLGIWAEEIDALLPSQRNRIVLSDNM
LGSQAEYECGMLCDLIHSEGAEVKAVYGDDFYRGMPALTVNKFGEGEAWYLATSPEEAFL
QDWLPQLCASRGIKPLVSGTPEGVETTIRSKDGQDYLFVLNHNADAVTVTLREQSGIDLL
TGASVQGGTTELKGYDVQIIKVNRE
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgataaatgcgaaaaaaccgaaaatctggtacggcggtgactataatccggatcaatgg
gagaaggaagtctgggacgaggatttacggatgttcaagctttccggaatcgatgtggca
acgcttaacgtatttgcctgggcaaaaaaccagcctgatgaggatacctacgatttcggc
tggctcgacgagatgatggacaagcttcatgcggacggcgttggcgtctgtctggctaca
agcacggcagcgcatcccgcgtggatggcccgtaaatatccggatgtgctgcaagtcgat
ttcaacggcaacaaacgcaagtttggcggccgccataactcctgtccgaacagcccaacc
ttccgcaagtattcggtgcgcatggccgagaagcttgccgagcggtacaaagatcacccg
gctctgctcatctggcatatcaacaatgaatacggcggcgcgggcaactgctattgcgac
aattgcgaagcggctttccgagtatggcttaaggatcgttacggaacgattgaagaagtg
aacaaagcttggaatacggcattctggggccatattttctacgactttgaagatatcgtt
ctgccaagcggccgcagcgaggaatggtacggcgcgaacggccggacggagacaaacttc
caaggtctgtcgctcgattacatgcgtttccattcggacagcctgctcgagtgctataag
ctggagtacgaagcggtcaagaaggttacgccggatattccggttacaaccaacctgatg
ggcgctttcaaaaagctggattatcataaatgggcgaagcacatggacgttgtatcctgg
gataactacccgcgcttcgatacgccgcacagctataccggcatgatgcatgatctgatg
cgaggcctgaaggacggccagccgtttatgctgatggagcagacgccaagccagcagaac
tggcagccgtacaactcgcttaagcgtccgggcgttatgcgcttatggagctaccaggcc
gttgcgcgcggagcggatacgatcctgttcttccagcttcgccgttcgaccggggcatgc
gagaaatatcacggcgcggttatcgagcatgtcggccacgagcatacccgcgtattccgc
gaatgcgcggagcttggcgcggagctcgggaagctgggagatactttgctggatgcgaga
gtgaaagcaaaggttgcgatcctgttcgattgggaaaactggtgggcgattgagatgtcc
agcggtccgtccattgctcttaaatacgtgaatgaagctcataaattctatgatgcgcta
taccgtgccggcattgcggccgatgtggtcagcgtagaagcggacctcagcggctacgac
ctggttatcgcgccggtcatgtacatggtgaaggatggcgtggcggagaagctggaagcc
tatacggctgccggcggcgcggttattacaacctacttcagcggtatcgtaaacgagacc
gatctggtaacgctcggcggttacccgggcaagctgcgcaaattgcttggcatctgggcg
gaagagattgatgccctgcttccttcgcagcgcaaccggattgttctgtcggacaacatg
cttggctctcaggcggaatacgagtgcggcatgctctgcgatctgattcactcggaaggc
gccgaagtaaaggccgtatacggggatgatttctaccgcggcatgcctgctctaacggtt
aacaagtttggcgaaggcgaagcctggtacctggcgacaagtccggaagaagccttcctg
caggactggctgcctcagctatgcgcttcccgcggcatcaaaccgctggtttccggcacg
ccggaaggcgtggagacaacgatccgctccaaagacggccaggattatctgtttgtgctt
aatcacaatgcggatgccgttacggttacgctccgagagcagtccgggattgatctgctt
actggcgccagcgttcaaggcggcacaacagagcttaaaggctatgacgtgcagatcatt
aaggttaatcgggaatag

DBGET integrated database retrieval system