KEGG   Paenibacillus sp. JDR-2: Pjdr2_1877Help
Entry
Pjdr2_1877        CDS       T00977                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.4)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pjdr2_1877 (gpmA)
   01230 Biosynthesis of amino acids
    Pjdr2_1877 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pjdr2_1877 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Pjdr2_1877 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pjdr2_1877 (gpmA)
Enzymes [BR:pjd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Pjdr2_1877 (gpmA)
Exosome [BR:pjd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Pjdr2_1877 (gpmA)
  Exosomal proteins of melanoma cells
   Pjdr2_1877 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2219819..2220565)
Genome map
AA seq 248 aa AA seqDB search
MKKIVLIRHGQSVWNVENRFTGWTDVDLSTQGLDEAREAGSILKKHGYVFDIAYTSVLKR
AIRTLWIILHEMDLLWIPEHKSWMLNERHYGALQGLDKAETAAKYGEDQVHLWRRSVDVR
PPALDSTDPRYAAADPRYLGLKEGEFPLTENLEDTEARVLKYWNAEIAPAISSGSQVIIA
AHGNTLRALVKYLDQIPPDGIADLNIPTGIPLVYELDDELKPVRHYYLGWEGPYPNGQIP
THIMPSTK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcgtcctgatccgccatggacaaagcgtatggaatgtcgagaaccggttc
acgggctggactgatgtagacctgtcaacgcaaggtctggatgaagccagggaagccgga
agcatcctgaaaaaacacggctacgtcttcgacatcgcctatacctccgtcttgaaacgc
gccatccgcaccttatggattatccttcacgagatggatctattatggataccggagcat
aaaagctggatgttgaatgagcggcattacggcgctctccaagggctggacaaagcggaa
accgccgccaaatacggagaggaccaggtgcatctatggcgcagatcggttgacgtccgc
cctccggcactcgactcgaccgatccgagatacgcagctgccgaccctcgttacctcgga
ctcaaggaaggcgaatttccgttaacggaaaacttggaagacacggaggcaagggttctg
aagtattggaatgcggaaatagctcccgccatttcctccggaagccaggttattatagcc
gcccacgggaacacgctgcgggcactggtcaaatatttggaccaaataccgccggacggc
attgcagacttgaatatccctaccggcattccgcttgtgtatgagctggatgatgaactg
aagccggtccgccattactatctcggctgggaaggaccctatccgaacggccagattcct
acgcatatcatgccttcgacaaaataa

DBGET integrated database retrieval system