KEGG   Paenibacillus sp. JDR-2: Pjdr2_2123Help
Entry
Pjdr2_2123        CDS       T00977                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pjdr2_2123
   01230 Biosynthesis of amino acids
    Pjdr2_2123
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pjdr2_2123
   00030 Pentose phosphate pathway
    Pjdr2_2123
   00051 Fructose and mannose metabolism
    Pjdr2_2123
   00052 Galactose metabolism
    Pjdr2_2123
  Energy metabolism
   00680 Methane metabolism
    Pjdr2_2123
Enzymes [BR:pjd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Pjdr2_2123
Protein phosphatases and associated proteins [BR:pjd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Pjdr2_2123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2503480..2504448
Genome map
AA seq 322 aa AA seqDB search
MSSVKSIAVLTSGGDSQGMNAAVRAVVRSALYNGLDVYGVQRGYQGLINDDLFKMDLRSV
GDIIQRGGTILQTARCKEFTTLEGQQRGAEVLRERGIDGLVVIGGDGSYQGANKLSKLGI
KTMGLPGTIDNDIPFTDFTIGFDTAVSIVVDAINKIRDTMSSHERSSVVEVMGRHCGDIA
LYAGLASGAETIIVPEVPIDMAEVSERMKSNFAKGKRHSIVVVAEGAGRGEDVAREITKG
CGLEPRVTVLGHIQRGGTPTAMDRILASRLGDFAVHQLMEGESGKACGIVRGELVTTDID
KVVHTKKPFNMEMYNLALRLSQ
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctgtaaaatctattgctgtattaacgagcggaggcgactctcaaggcatgaac
gcggcggttcgcgccgttgtccggagcgctctgtataatggtctcgatgtatatggcgtt
caacgcggctatcaaggtctgatcaatgatgaccttttcaaaatggatctccgcagcgta
ggcgatattattcaacgcggcggcaccatacttcaaacggcgcgttgtaaagagtttacg
acgcttgaaggtcaacagcgcggcgctgaagtactgcgtgagcgcggtatcgatggtcta
gttgttattggcggcgacggttcttatcaaggcgctaacaaattgagcaagcttggcatt
aagacaatgggtctgcctggcacgatcgacaatgatattccgtttacggactttacgatc
ggcttcgatacggctgtcagcattgtagtcgacgcaatcaacaaaatccgtgacaccatg
tcttcgcatgaacgttcgtcggtcgtggaagttatgggacgccactgcggagatatcgct
ttgtatgcgggtcttgcgagcggcgcggaaacgattatcgttcctgaagtgccaatcgac
atggctgaagtgtccgagcgcatgaagagcaactttgccaaaggcaaacgccatagtatc
gttgttgttgccgaaggcgcgggacgcggtgaagacgtggcgagagaaattacgaagggc
tgcggactggagcctcgcgtaacggttcttggtcacattcaacgcggcggcacgccaacg
gccatggaccggattctggcaagccgtctgggcgactttgccgttcatcagctgatggaa
ggcgagtccggcaaagcctgcggtattgtccgcggcgagctggtgacgacggatattgat
aaagtcgttcacaccaagaagccgtttaatatggaaatgtacaacctggctcttcgcctt
tcccaataa

DBGET integrated database retrieval system