KEGG   Paenibacillus sp. JDR-2: Pjdr2_2258Help
Entry
Pjdr2_2258        CDS       T00977                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pjd00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2648436..2650382
Genome map
AA seq 648 aa AA seqDB search
MIQTAPYGLLLSDLYLFNKGCSHHSYRFMGAHVMDWDGKDGVRFAVWAPHAREVRLVGQH
NNWDGSGSLMERVSSTGVWVLFIPGLSEGAVYKYEILTSTGQRLLKADPYAFLAERRPQT
ASVVSDLYGFPWRDKKWMDSRHKSPAYSNPLMLYEVHAGSWQLKGEENFLTYEELAEQLV
PYVAKMGYTHIELMPINEHPFDQSWGYQITGYYAPSSRYGKPKQLMKFIDRCHAYGIGVI
LDWVPGHFCKDEHGLRGFDGTPIFEGNDERLAEKPLWGTLAFDFKRNEVISFLISNAIYW
MEMFHFDGLRIDAVASMINLHMDKPPELFTWNEYGGTDNLDALRFMKRLNETVFHYYPDA
LMIAEDSSAWPAVTSPTYLGGLGFNFKWNMGWMNDVLQYMSMDPADRTHHHHLLTFSLLY
AFSENYVLPFSHDEVVHGKRSLLNKMPGSYEEKFAQLRLLYGYWIAHPGKKLLFMGSEWG
QFDEWKDREPLDWMLLEYDLHGKMHHYVKALNHVYTHEPSLWERDQDAYAFQWIDVNNAE
QSIISFIRYGKQGFTVTVANFSRNGYTHYRLGVPQPGCYRMILNSNEVQFGGSDSQCLQK
HDSEKVSWHGYNQSISINLPPLSFQLFSYAGGGDHIKKGLVSWVEKRK
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaacggcaccatatggccttctgctgagcgatttgtatctgttcaacaaaggc
tgctctcaccacagttaccggttcatgggcgcgcatgtcatggactgggacggtaaagat
ggcgtcaggtttgcagtgtgggctccgcacgccagggaggttcggcttgttggccagcat
aacaactgggatggttccggttcgttaatggagcgcgtatcttcgacaggagtctgggtt
ctctttataccggggctttccgaaggtgctgtctacaagtacgagattttgacctcaaca
ggtcagcggctgctcaaggcagatccttacgctttcctcgccgaaaggcgtcctcaaacc
gcctccgtagtgtctgatctatacggattcccgtggcgggataagaaatggatggactca
aggcacaagtcgcctgcttactccaatccattaatgctttacgaagtgcatgccggctcc
tggcagctgaaaggggaggagaacttcctcacctatgaagaactagccgaacagcttgtt
ccttacgtagctaagatgggatatacccatatcgagctgatgccaatcaacgaacatcct
ttcgaccagtcttggggttatcaaattaccggttattatgcgccgtccagccgttacggc
aagcctaagcaactgatgaaatttatcgaccgctgccacgcgtacggcattggcgtcatt
ctggactgggttcccggacatttctgcaaggatgaacatggattgcgcggctttgacggt
actccgatctttgaaggaaatgacgagcggcttgccgaaaagcctttatggggaacactg
gccttcgatttcaagcgaaacgaagtgatcagcttcctgatctccaacgccatctactgg
atggaaatgttccacttcgacggtcttcggattgatgccgtcgccagcatgatcaatctc
cacatggataaaccgcccgagctcttcacctggaacgagtacggcggcaccgacaatcta
gacgctctccgcttcatgaaacggcttaacgaaaccgtatttcactactacccagacgca
ctaatgatcgcagaagattcttccgcttggcctgcagtcacctcacctacatacttaggc
gggctgggatttaactttaaatggaatatgggctggatgaacgacgtgctccaatacatg
tcgatggatcctgccgaccgcacacaccaccaccacttacttactttctcacttttgtac
gctttctctgaaaattacgttttaccgttctcgcatgacgaggttgttcacggcaagcgt
tccttgctgaacaaaatgccaggctcctacgaggagaaatttgcccaattgcggttgtta
tacggctattggatcgctcatccgggcaagaagctgctgtttatgggcagtgaatgggga
cagttcgacgagtggaaggaccgcgaaccactggactggatgctgctcgaatacgatctc
cacggcaaaatgcaccattacgtcaaagctttgaaccatgtttatacccatgaaccgtct
ctatgggaaagagatcaggacgcttacgcatttcaatggattgatgtgaataatgctgaa
caatcgatcatatctttcattcgttatggcaagcagggcttcactgttacggttgccaac
ttctccagaaacggttatacccattatcgattaggcgtgccgcagccgggctgttatcgc
atgatcctaaacagcaatgaggtacagttcggaggttccgattcacagtgtttacagaag
catgacagcgagaaagtgagctggcacggctataaccagagcatttccatcaatctcccc
cctctatccttccaattattcagctatgcgggcggcggagaccacattaagaaggggttg
gtgtcatgggtcgaaaaaaggaaatga

DBGET integrated database retrieval system