KEGG   Paenibacillus sp. JDR-2: Pjdr2_2419Help
Entry
Pjdr2_2419        CDS       T00977                                 

Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pjdr2_2419
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pjdr2_2419
Enzymes [BR:pjd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Pjdr2_2419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2787163..2787960
Genome map
AA seq 265 aa AA seqDB search
MFLDKIVVTKREEVAHLASDFQLADYERKIASLPECRGFERALTSGRKRDVGLIAEVKKA
SPSKGLIRPDFHPAELAAAYERAGADCLSVLTDRDYFQGSNEYLTLIKETVSNPLLRKDF
IIDYRQVYEARVIGADAVLLIAAILTSSELSELYDTAKSLGMDVLVEVHDREELERVLEL
DKATLIGVNNRDLKSFVTDLHTTEALIDLIPKGVTVISESGIAGRKDMDYLQTVGAQGVL
IGEHFMRQPDAGQAVIDLMGPVTRA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgataaaatcgtagtaacgaagcgggaagaggttgctcatctcgcttcggac
ttccagctagccgattatgaacgcaaaatcgcttcgcttcccgaatgccgcggcttcgaa
cgcgcgctaacgtccggccgcaaacgggatgtcggcctgattgcggaagtgaagaaggca
tccccatccaaaggccttatccgtcctgattttcatcctgccgagcttgcggccgcttat
gagcgcgcaggcgcggactgtttatcagtgctgacggaccgcgattatttccaaggctcc
aatgaatacttaaccctgatcaaggagacggtcagcaatccgctgctccgcaaagatttt
attatcgattaccgtcaggtatacgaggctcgtgttatcggagcggatgcggtactatta
atagcagcaattcttacatcttccgagctgtcggagctgtatgacacggcaaaatcgctt
ggcatggacgttcttgtagaggttcatgaccgcgaagagctggagcgggttctagagctt
gataaagcgaccctgattggcgttaacaaccgagacctgaagtccttcgtaaccgatctt
cacacgacagaggctcttatcgatctcatacccaaaggagttacggtaataagcgaaagc
ggcattgcagggcgcaaggacatggattaccttcaaaccgtcggtgcgcaaggcgtcctg
atcggcgaacatttcatgcgccagccggatgccggacaggctgttatcgaccttatgggt
ccggtgacgcgggcatga

DBGET integrated database retrieval system