KEGG   Paenibacillus sp. JDR-2: Pjdr2_2422Help
Entry
Pjdr2_2422        CDS       T00977                                 

Definition
TspO and MBR-like proteins (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pjdr2_2422
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pjdr2_2422
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pjdr2_2422
Enzymes [BR:pjd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pjdr2_2422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2789809..2790615
Genome map
AA seq 268 aa AA seqDB search
MNLIDAAFAKLKQEGKTALIPFLTIGDPDIPTSIAIIKELEQAGADLVELGVPYSDPLAD
GPVIQRASERALKNRISILDCIETAAQAREAGVKLPFILFTYFNPVLQFGLEDFMNLVVE
KGISGLIIPDLPIEEDEEVRTLAEAKGVHLIPLVAPTSKDRVVRISKKARGFVYCVSSLG
VTGVRAEFHSGIDEFLATVREATDLPIAVGFGISSREQVERFEKICDGVVVGSAIVRKIE
ETLPKLSDSSKREDGLAEIRSFVAGFKG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gtgaatttgattgatgctgcttttgccaaattgaagcaagaaggaaagacggcgcttatt
ccgtttttgacgattggggatccggatatccctacatcaatcgctattattaaagagctt
gaacaagcaggcgcggatctcgttgagcttggtgtcccttattccgacccgcttgcagac
ggtcccgttattcaacgggcatccgaacgcgctcttaagaaccgtatttcgattctggat
tgcatcgagacggctgcgcaagcccgtgaagccggcgtcaagctgccgtttattttgttt
acttatttcaatccggtgctgcaatttggcctggaggactttatgaatcttgtcgtggaa
aagggaatcagcggtcttattattccggatcttccgattgaagaggatgaggaagtacgt
acgctggctgaagcgaaaggcgttcaccttattcctttggtagccccaacttctaaggac
cgcgttgtccgcatttccaagaaagcacgcggctttgtctactgcgtatcctcgctgggg
gtaacgggagtccgtgccgaattccacagcggaatcgacgaattccttgcaacggttcgc
gaagcaacagacctgccaattgccgtgggctttggtatttccagccgcgagcaggtggag
cggttcgagaaaatctgcgacggcgtagtcgtaggcagcgcgattgtgcgcaaaatcgaa
gaaacgcttcctaaattaagcgattcttcgaagcgggaagatggacttgccgaaatccgc
agctttgttgccggattcaagggctga

DBGET integrated database retrieval system