KEGG   Paenibacillus sp. JDR-2: Pjdr2_2626Help
Entry
Pjdr2_2626        CDS       T00977                                 

Definition
acireductone dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Pjdr2_2626
Enzymes [BR:pjd01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Pjdr2_2626
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Pjdr2_2626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3041898..3042437)
Genome map
AA seq 179 aa AA seqDB search
MAEIRIRNTNERISGEQNVREFLENQEVLYEHWDATKLPAHLQEKFVLSDEEKAEVLSTF
NADITDLAARRGYKTWDIITLSDATPNLDELLKKFESVHTHTEDEVRAITAGKGIFVIKG
TEEVGYFDVELEAGDVISVPERIPHFFTLMDNRQIVAVRLFIETEGWIAHPFEDPAFVK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaatccgcattcgcaatactaatgaacgtatttctggagaacagaacgttcgt
gaatttttagaaaatcaagaagttctttatgaacattgggatgctactaaacttcctgca
catcttcaagagaaatttgttctctccgatgaagagaaagcagaggttctgtccaccttc
aatgccgatattacggatcttgccgctcgccgcggttacaaaacttgggacatcattaca
ttatccgatgcaactccaaaccttgatgaactgctgaagaaattcgaatccgttcataca
catacagaagatgaagttcgcgcgattacagccggcaaaggcatcttcgttatcaaaggt
accgaagaagttggttacttcgatgttgaactcgaagctggcgacgttatctccgttccg
gagagaatccctcacttcttcactttgatggataaccgccaaatcgtagccgtgcgtctg
ttcatcgaaacagaaggctggattgctcatccgttcgaagaccctgctttcgttaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system