KEGG   Paenibacillus sp. JDR-2: Pjdr2_2626Help
Entry
Pjdr2_2626        CDS       T00977                                 

Definition
acireductone dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pjd00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3041898..3042437)
Genome map
AA seq 179 aa AA seqDB search
MAEIRIRNTNERISGEQNVREFLENQEVLYEHWDATKLPAHLQEKFVLSDEEKAEVLSTF
NADITDLAARRGYKTWDIITLSDATPNLDELLKKFESVHTHTEDEVRAITAGKGIFVIKG
TEEVGYFDVELEAGDVISVPERIPHFFTLMDNRQIVAVRLFIETEGWIAHPFEDPAFVK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaatccgcattcgcaatactaatgaacgtatttctggagaacagaacgttcgt
gaatttttagaaaatcaagaagttctttatgaacattgggatgctactaaacttcctgca
catcttcaagagaaatttgttctctccgatgaagagaaagcagaggttctgtccaccttc
aatgccgatattacggatcttgccgctcgccgcggttacaaaacttgggacatcattaca
ttatccgatgcaactccaaaccttgatgaactgctgaagaaattcgaatccgttcataca
catacagaagatgaagttcgcgcgattacagccggcaaaggcatcttcgttatcaaaggt
accgaagaagttggttacttcgatgttgaactcgaagctggcgacgttatctccgttccg
gagagaatccctcacttcttcactttgatggataaccgccaaatcgtagccgtgcgtctg
ttcatcgaaacagaaggctggattgctcatccgttcgaagaccctgctttcgttaaataa

DBGET integrated database retrieval system