KEGG   Paenibacillus sp. JDR-2: Pjdr2_2656Help
Entry
Pjdr2_2656        CDS       T00977                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pjdr2_2656
   00670 One carbon pool by folate
    Pjdr2_2656
Enzymes [BR:pjd01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Pjdr2_2656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3075111..3075602
Genome map
AA seq 163 aa AA seqDB search
MSITMIAAMDRGRTIGIGNKLPWRLPAEMAYFTRHTTGKAVVMGRKTFESLPKPLKDRTN
VVITRQPEYAKEGCEVVHSVQEAIDRYGEGELMVIGGADIYAQFLPFADKIRLTEVDTNI
EGGDAFFPTFNEGEWERVDAEKVESDERNAFSFTFQTFARRNA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattacgatgatcgcagcaatggaccgtggccgcacgatcggaatcgggaataag
ctgccatggcggcttccggctgagatggcctactttacgcgccatacgacagggaaagcc
gttgttatgggtcgcaagacgttcgaatcgctgcccaagccgctgaaggaccggacaaat
gtcgtaataaccagacagccggaatacgccaaagaaggctgtgaggttgtacattccgtg
caggaagcgattgaccggtacggtgagggggaactgatggtaatcggcggtgcggatatt
tatgcacagtttcttccattcgcggataaaatccggcttaccgaagtggatacaaatata
gaaggcggcgacgcgtttttccctacgtttaacgaaggcgaatgggaacgcgtggatgca
gagaaggttgaaagcgacgagcgtaacgcattctccttcactttccaaacatttgcccgc
cgaaatgcataa

DBGET integrated database retrieval system