KEGG   Paenibacillus sp. JDR-2: Pjdr2_2862Help
Entry
Pjdr2_2862        CDS       T00977                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pjdr2_2862
   01230 Biosynthesis of amino acids
    Pjdr2_2862
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pjdr2_2862
  Energy metabolism
   00680 Methane metabolism
    Pjdr2_2862
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pjdr2_2862
Enzymes [BR:pjd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Pjdr2_2862
Exosome [BR:pjd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Pjdr2_2862
  Exosomal proteins of melanoma cells
   Pjdr2_2862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3293452..3294018
Genome map
AA seq 188 aa AA seqDB search
MNTIIYMVRHAESPYNEGTERTRGLTTKGKGDVEKVTEILKEEGIDVLVSSPYNRAILSI
EGLAQNLGLDIETFEDLRERHFAREIIENLMSVISEKFYDFDYSLPGGESNSECQNRSVS
VIKNILKEHSGKKIAIGTHGLVMTLMMNYFDSSYGLDFLNQLKKPDIYKLSFENLELKEV
IRLWNGDL
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccattatctatatggttaggcatgctgaatcaccatacaatgaaggaacagaa
agaacaaggggacttaccactaagggcaagggcgatgttgaaaaagttacagaaattctt
aaggaagaaggaattgacgtccttgtatctagcccgtataaccgagcaattctgagtatt
gagggattggcacaaaacttgggattggatatcgaaacatttgaagatctcagggaaagg
cattttgctagagaaattattgaaaatttaatgtcggtcattagcgagaaattttatgat
ttcgattattctttaccgggtggggagtctaattctgaatgccagaatagatctgtatca
gtgataaaaaacatattaaaagaacactccgggaaaaaaatagctattggaacacatgga
cttgtgatgacgttgatgatgaattattttgattcaagttatggtttggattttttaaat
caattaaagaaaccagatatttataaattaagttttgaaaatttagaattaaaagaagta
ataagactgtggaatggggatctctga

DBGET integrated database retrieval system