KEGG   Paenibacillus sp. JDR-2: Pjdr2_3158Help
Entry
Pjdr2_3158        CDS       T00977                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Pjdr2_3158
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Pjdr2_3158
Enzymes [BR:pjd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Pjdr2_3158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3612619..3613830
Genome map
AA seq 403 aa AA seqDB search
MRYLRIFTFYATILTLLVLTGCGTAEPQQPVISETPTPVDPIADLVASMSLSEKIGQMIL
VGMDGTEIQPEISKLIKESHVGGIILYSNNIESASQTIKLANDLKQINQDNGAKLPLLLS
TDQEGGRVSRLPKQIKPFPASRTIGKTNDPQYAYQVGTALGEAVKAIGLNTDFAPVLDIN
TNPKNPVIGNRAFGTTAELVSRMGVQEMLGIQSQGVIPVVKHFPGHGDTSVDSHLGLPVV
DHDLERLRSIEFVPFSSAIKEGAPMVMVAHILMTKLDPDTPASMSKKVIQDYLRGELKFS
GVVITDDMTMGAVGKVKAIGPATVQSVLAGADIILVGHDPVQQQTVIDALTAAAQSGEIS
PSVLDASVYRIIKLKQSFKLSDQPTSSIDITTLNQHIQAALEK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcgatatcttcgaatctttacgttttacgcgactattcttacactccttgttctaacc
ggatgcggaacggcagagcctcagcaaccggtgatcagcgagactccaacacctgtcgat
ccgatagccgaccttgtagcatccatgagcttatccgaaaagatagggcaaatgatattg
gtgggaatggacggcacggaaatccaacctgaaataagcaagctgatcaaagagagccat
gttggagggattattttatatagcaataatatcgagtccgcatcgcagacaattaagctg
gctaatgatctcaagcaaatcaatcaagataatggcgcaaagcttccgctgctcttaagc
acggatcaggaaggcggacgggtttcccggttgccgaagcaaatcaagccattcccggca
agcagaactattggcaagaccaatgatccccaatatgcctatcaggtgggaacagcctta
ggcgaagcggtgaaagcgattggcttgaataccgattttgcaccggttcttgatatcaat
acaaaccccaaaaatccggtcatcggcaaccgcgcttttggtaccacggcagaattggtc
agccgtatgggggtgcaggagatgcttggcatccaatcgcaaggcgttatcccggtggtc
aagcattttcccggacatggcgacacctccgtcgattcccaccttgggctgcctgtggtc
gaccacgatctggagcggctccgctccattgagtttgtaccgttcagttcggcaattaaa
gaaggagcccctatggtgatggtcgctcatatcttaatgaccaagcttgatccggacaca
ccggcttcaatgtccaagaaagtcattcaggattatttgagaggggagcttaagttcagc
ggagttgtaattacggatgacatgacaatgggggccgtaggaaaggttaaagctattggg
cctgcaacggtacaatcagtgttagccggcgcggatattattcttgtcggtcatgatccg
gtgcagcaacagaccgttatcgatgccctgactgcagcggctcaaagcggtgaaatttct
ccgtctgttctggatgccagcgtgtatcgcataatcaagctcaagcaaagctttaaatta
tcggatcaaccaacttcgtcaatcgatataacaacgctaaatcaacacattcaagcagct
ttggaaaaatga

DBGET integrated database retrieval system