KEGG   Paenibacillus sp. JDR-2: Pjdr2_3282Help
Entry
Pjdr2_3282        CDS       T00977                                 

Definition
fructose-16-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pjdr2_3282
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pjdr2_3282
   00030 Pentose phosphate pathway
    Pjdr2_3282
   00051 Fructose and mannose metabolism
    Pjdr2_3282
  Energy metabolism
   00680 Methane metabolism
    Pjdr2_3282
Enzymes [BR:pjd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Pjdr2_3282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3751989..3753920
Genome map
AA seq 643 aa AA seqDB search
MDAQFLDLLAQKYDTEEKVVTEIINLEAISNLPKGTEHFVSDLHGEFQAFQHVLRNGSGT
VKEKIKALFREDWTDHEINDFTALVYYPEEKIQLVKGDLCNKQALNRWYRKTIEQMLKLI
SFASSKYTRAKLRKALPEQFVYIVEELLYKTDLTNNKDPYYEEIYRQIISLGQADKLIIG
LAYTIQRLVVDHLHVVGDIYDRGPDPDKIMDTLIDYHSVDIQWGNHDVLWIGAYAGSLVC
LANIIRICARYDNLDIIEDVYGINLRPLLNLAEKYYNDNPAFRPKLQTDHNGSEQEILQI
TKIHQAIAMIQFKLEIPIIKRRPYFNMSNRLLLEQIDYDKNEIKIGGKTYPLENTCFATV
NPQQPEQLLEEEQQVMEKLLLSVQHSEKLARHMSFLMKKGSLYLIYNGNLLFHGCIPLDE
EGNMEEMQIEDKKYSGRQLLDVFEYYLRYAFAHPEDTDDLATDMVWYIWTGECSSLFGKK
EMTTFERYFIQDKETYKERKNPYYHLREVEEICRKILLEFVMNPDHGHIINGHTPVKEIR
GENPVKANGKMVVIDGGFSKAYQSTTGIAGYTLLYNSFGMQLVAHQKFISKEDVLCNGTD
VLSVKRLVDKELERKLVRETNVGEKLLQKISNLKNLLEYRYMK
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
ttggatgcgcagtttctagatttattagcccagaaatatgatacggaagaaaaagttgta
acagaaatcatcaaccttgaagcgatctccaatcttcccaagggaactgagcattttgtc
agtgatttgcatggggagttccaagcttttcagcatgtactaagaaacggttcaggcacc
gtaaaagagaaaatcaaagccttgttccgtgaggattggacggatcatgaaatcaatgat
tttacggcgttagtctattatccggaagaaaaaatacagctggttaaaggagacctgtgc
aataaacaagccttaaaccgatggtatagaaaaacgattgaacaaatgcttaagctcatt
tcattcgcctcatccaaatatacgcgggccaaattgcgcaaggctctgccggagcagttc
gtatatattgtagaagagcttctatacaagacggatttgaccaacaataaagacccttat
tatgaggaaatataccggcaaattatttccttgggccaggcggacaagcttattattggc
cttgcttatacgatccagcgcctggtggttgaccatcttcatgtggtcggggatatctat
gatcgcgggccggaccccgataaaatcatggacacgctgatcgactaccattccgtagac
attcagtgggggaaccatgatgtcctgtggattggcgcctatgcgggttccttggtctgc
cttgcgaatattatccggatctgcgccagatacgacaatctggacatcatcgaagacgta
tacggaatcaatcttcgtccactgctcaatttggcggagaaatactataatgacaatccg
gcttttagaccaaagctgcagaccgaccataacggctcggagcaggaaatcctgcagatc
accaaaattcatcaagccattgccatgattcagtttaagcttgaaatcccgattatcaag
agacgcccatactttaatatgtctaacaggcttttgcttgagcagatcgattacgacaag
aatgaaatcaagatcggcggaaaaacttacccgctggaaaacacctgttttgcaaccgta
aatccgcagcagcctgaacaattgctggaggaagaacaacaggtaatggaaaagctgctg
ttatccgttcagcattccgaaaagctggccagacatatgagttttcttatgaaaaagggt
agcctttatttaatatataacgggaatttgttatttcacggctgcattcctttggatgaa
gaaggaaacatggaagaaatgcagattgaagacaagaagtattcgggccgtcagttgctc
gatgtttttgaatattatttacgttacgcctttgcgcacccggaagatacggatgatctg
gctacggatatggtatggtacatctggacaggggaatgttcgtcgctctttggaaagaaa
gaaatgaccacctttgaacggtactttatccaagataaagaaacctataaggagagaaag
aacccctattaccatctgcgtgaagttgaggagatatgccggaaaatcctgctggagttt
gttatgaatccggatcatggtcatatcattaacggccacacgcctgttaaagaaattcgt
ggagagaaccccgttaaagcaaacgggaaaatggttgtcattgacggcggtttttccaaa
gcctatcaatccacaacgggcatcgccggatataccttgttgtataattcctttggcatg
cagctcgttgcccatcagaaatttatttcaaaagaagatgtgttatgtaacggaacggac
gtattgtctgtaaaaaggctggtggacaaagaactggagcggaagctggtgagggaaacc
aatgtcggggagaagctgctgcagaaaatctcaaatttgaagaatctcctagaatatcgc
tatatgaaatga

DBGET integrated database retrieval system