KEGG   Paenibacillus sp. JDR-2: Pjdr2_3415Help
Entry
Pjdr2_3415        CDS       T00977                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00900  Terpenoid backbone biosynthesis
pjd01100  Metabolic pathways
pjd01110  Biosynthesis of secondary metabolites
pjd01130  Biosynthesis of antibiotics
Module
pjd_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pjdr2_3415
Enzymes [BR:pjd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Pjdr2_3415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C NAD_binding_3 Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ACT02050
JGI: Pjdr2_3415
UniProt: C6D2T3
Position
complement(3899228..3900367)
Genome map
AA seq 379 aa AA seqDB search
MKKITILGSTGSIGTQTLDVIANDPDRYQVVGLSAGNNLQLLIEQAKQFRPSVVCLANKE
LAEQAKPELPSGTQVLYGEEGLVEIAANNDADVVVTAIVGSRGLPATLAAIEAGKTIALA
NKETLVTAGHIVMERARQKGVSIIPVDSEHSAIFQCLNGEDPKALQQLTLTASGGSFRDR
TREQLEGVSVAEALNHPNWSMGAKITIDSATMVNKGLEVIEARWLFDVTYDQIKVLIHPE
SIIHSFVEFSDNSVIAQLGMPDMRVPIQYALTYPNRLPTPTGRLDLAAIGKLHFREMDFA
RYPCLKLAFDCGRAGDSAPTVFNAANEVAVARFLNGEIDFLGIERVLERVLERHSVTAVN
DLQAIAEIDAWARKEAAII
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcaccatattaggctccaccggctctatcggcacccagacgcttgacgtc
atagccaatgatccggaccgctatcaggttgtcggcttatcggcaggcaataaccttcag
ctgctgatcgagcaggctaagcaattccggccttctgtggtttgcctcgctaataaggag
ttggctgagcaagcaaagcctgaattgccttcgggcacgcaggtcctgtatggcgaggag
ggtcttgtagaaatcgcggcgaataatgatgccgacgttgttgtaacagcgattgttggc
agccgtggacttcctgcaactcttgccgctattgaggctggcaagacgattgcgctggcg
aacaaagaaaccctcgtgacggccggtcatatcgtaatggagcgtgccagacaaaaaggc
gtctcgattataccggtggacagcgagcattcggcgattttccaatgcttgaacggggaa
gatcctaaagctttgcagcagcttaccctgacggcatcgggcggatcgttccgcgaccgt
actcgtgaacagttggaaggcgtatcggtagctgaagcgttaaaccatccgaactggtcc
atgggagccaagattacgatcgattccgctaccatggtgaacaaagggctggaggtcatc
gaagctagatggctgtttgatgtgacctacgatcagattaaggtcttgatccatccggaa
agcatcatccattcgtttgtggaattcagcgacaacagcgtaattgctcagttgggcatg
ccggatatgcgggttcctatccagtacgcgctgacttatccgaatcgccttccaaccccg
actggccggctcgatctagcggcaatcggaaaattgcatttccgcgagatggatttcgcc
agatacccatgtctcaagcttgcctttgactgcggccgtgccggtgattcggctccaacc
gtgtttaatgcagctaacgaggttgctgtagcccgtttcctgaacggggagattgatttc
ttgggcattgagcgagtgctggagcgcgttctcgagcgccactcggtaacagcagtaaat
gatttgcaggctattgcagaaattgatgcttgggctcgtaaagaggccgcaatcatctag

DBGET integrated database retrieval system