KEGG   Paenibacillus sp. JDR-2: Pjdr2_3433Help
Entry
Pjdr2_3433        CDS       T00977                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pjd02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pjd02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3913145..3914473)
Genome map
AA seq 442 aa AA seqDB search
MAPYRVLVVDDSPFMRKIFSDLIVQDPQFTIVATACNGLEAIEAVKKWKPDAVTLDLEMP
ELNGLDALQRIMIEQPTPVIMLSGISEENTRETIKALQLGAFDFIRKPMGAFSNDIVRVG
ELLLEKLRIAVLTRRYSASVMDTDKKKASMKRDKPEQSQLVQPVKSLEERKNRKRGLLQP
EQQAEARDASAPAFEKKTRASGGLRNPIKPLTDGGRPYEAAPIIPVAPVAAALEENREQK
RYRQKTASDSFDQLIAIGTSTGGPRALHEVITSLPARLAAPVLVVQHMPPKFTKSLAQRL
DSFSELEVVEASQGERLKAGVVYIAPGGHHMELAKDQSGYYVQLTQKPPCNGHRPSVDVL
FESLTPFDELKRHAVIMTGMGSDGAKGMKALVDSGAESAIAESEQTCVVYGMPRSAIETG
CVKTVLPLQQIAAELQHAVLKG
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggctccttatcgcgtgctggtcgtggacgattcgcctttcatgagaaaaatattcagc
gatctaatcgttcaagacccccaatttacgattgtggcaaccgcttgtaatggtcttgaa
gccattgaagccgtcaagaagtggaagcccgatgctgtaacccttgatcttgagatgccc
gagcttaacgggctcgatgccctgcagcggatcatgatcgaacagccgacacctgtgatc
atgttatccggcatcagcgaagagaacacgagagaaaccattaaggcactgcagttaggg
gcttttgactttatccgcaagccgatgggcgctttctcaaatgatattgtccgggtcgga
gagctgttgctggagaagctcagaattgcggtcttgactagaaggtattcagcctctgtt
atggacacggataagaagaaagcttccatgaaacgggacaagcccgagcagtcacagctt
gtacagcccgtgaaatcgttggaagaaaggaaaaaccgaaagcgtgggcttctgcagccg
gaacagcaggcagaggcaagagatgcatctgctccggcatttgagaagaaaaccagagca
tccggtggcttaagaaatccgataaagccattgactgatggcggcagaccttatgaggca
gcaccgattataccggttgcgccagtcgcagcggcactggaggaaaacagagaacagaag
cggtatagacagaagacagcatcggacagctttgatcaattaattgccatcggaacttca
actggcggtccacgcgctttgcatgaagtgatcacttcgcttccggcccggttggccgcg
cccgtattggttgtccagcatatgcctcccaagtttacaaaatcgcttgcccagcgtctg
gacagctttagtgagcttgaggttgtggaggcttcacagggtgagcggttgaaggccggg
gttgtctatatcgcccccggcggtcatcacatggaactggcaaaggaccagagcggttat
tatgtccagcttacccagaagccgccgtgcaacggacatcgtccttcggttgatgttctg
ttcgaatcattaaccccatttgacgagctgaaacgtcacgccgtcatcatgacgggaatg
ggaagcgacggagccaaagggatgaaagctctcgtcgacagcggcgcggaatcggcgatt
gccgaatccgaacagacctgcgtcgtttatggaatgccgcgcagcgcaatagagaccggc
tgcgtgaagacggtactgcctctgcagcagattgctgccgagctgcagcatgcggtattg
aaaggataa

DBGET integrated database retrieval system