KEGG   Paenibacillus sp. JDR-2: Pjdr2_3468Help
Entry
Pjdr2_3468        CDS       T00977                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00020  Citrate cycle (TCA cycle)
pjd00640  Propanoate metabolism
pjd00660  C5-Branched dibasic acid metabolism
pjd01100  Metabolic pathways
pjd01110  Biosynthesis of secondary metabolites
pjd01120  Microbial metabolism in diverse environments
pjd01130  Biosynthesis of antibiotics
pjd01200  Carbon metabolism
Module
pjd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pjd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pjdr2_3468
   00640 Propanoate metabolism
    Pjdr2_3468
   00660 C5-Branched dibasic acid metabolism
    Pjdr2_3468
Enzymes [BR:pjd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Pjdr2_3468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ACT02101
JGI: Pjdr2_3468
UniProt: C6D2Y4
Position
complement(3945612..3946772)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQGKEVLKQYGVAVPEGKVAFSVDEAVEAAQSLGTPVVVVKAQIHAGGRGKAGGV
KVAKNIDEVRAYASEILGKVLVTHQTGPEGKEVKRLLIEQGCDIKKEYYVGVVIDRGTGR
VTMMASEEGGTEIEEVAAHSPEKIIKEVIDPAIGLQVFQARKLAYAINIPSELVNKAVKF
MIALYTAFVDKDCSIAEINPLVVTGDGNVMALDAKLNFDSNALYRHKDIVALRDLEEEDA
KEIEASKYDLSYIALEGNIGCMVNGAGLAMATMDIIKYYGGDPANFLDVGGGATKEKVTE
AFKIILSDENVKGIFVNIFGGIMRCDVIADGVIAAARELGLDRPLVVRLEGTNVELGKKM
LNESGLNIVAADSMADGAQKIVNLVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtatcaaggtaaagaggtcctgaaacagtacggtgttgctgttcca
gaaggaaaggtagcgttctccgttgacgaagcggtagaagcggcgcaatcgctgggcact
ccagtggtagttgtaaaagcgcaaattcacgctggcggccgcggtaaagcgggcggcgtt
aaagtagcgaaaaacattgatgaagttcgtgcatatgccagcgagattcttggtaaagtg
ctcgttactcatcaaaccggccctgaaggtaaagaagttaaacgtcttcttatcgagcaa
ggctgcgacatcaagaaagaatattacgtgggcgttgttatcgaccgtggtacaggccga
gtaaccatgatggcttccgaagaaggcggcacggagattgaagaagtagcagctcattcg
cccgagaagatcatcaaagaagttatcgaccctgcaatcggtctgcaagtgttccaagca
cgcaaacttgcttatgcaatcaacattcctagcgagctagttaacaaagcggttaaattc
atgatcgctctgtacacggcattcgttgataaagattgctccatcgccgagatcaatccg
cttgtcgttactggcgacggcaacgttatggcgcttgacgctaagctgaacttcgattcc
aatgctctgtaccgtcacaaagatatcgtggcgttacgcgacctggaagaagaagatgca
aaagaaatcgaagcatccaaatacgacctcagctacattgcccttgaaggcaacatcggc
tgtatggttaacggcgccggccttgctatggcgactatggacatcatcaaatactacggc
ggcgaccctgccaacttcctggacgtagggggcggcgctacaaaagagaaagtaactgaa
gcgttcaaaatcatcctgtccgacgagaacgtaaaaggtattttcgttaatatcttcggc
ggcatcatgcgttgcgacgttatcgctgacggcgtaattgccgctgcgagagagcttggc
cttgaccgtcctttggttgttagactggaaggcactaacgttgagcttggtaaaaaaatg
ttgaacgaatcgggattaaacattgttgcggctgactccatggcagacggcgcgcaaaaa
atcgttaatctcgtcaaatag

DBGET integrated database retrieval system