KEGG   Paenibacillus sp. JDR-2: Pjdr2_3864Help
Entry
Pjdr2_3864        CDS       T00977                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Pjdr2_3864
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pjdr2_3864
Enzymes [BR:pjd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Pjdr2_3864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4409373..4410275)
Genome map
AA seq 300 aa AA seqDB search
MTTMTQLKQRSLLGLKDLSKEEIESILDRAAYWEQHPNKVHNVMQGKFAANMFFENSTRT
RFSFEVAEKRLGAEVLNFSAAVSSVQKGESIYDTVRTLESMGIDVGIIRLKPIGVLAELA
TKIQVPLINAGDGNNEHPTQALLDLYTMRKHFGNLNGLTVSIIGDVLHSRVARSNLWALR
KFGAKVQFCSPSNMTATDLDVPYVTMDEALKADVVMMLRVQLERHESGMLNSAEAYREQF
GLTVERASQIAEHAIIMHPAPINRGVEIDDELVEHPQSRIFPQMANGVPIRMAVVERALS
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgatgacacaacttaaacaacgcagtttgcttggacttaaagatctcagcaaa
gaagaaattgaatcgattttggatcgtgcggcttactgggaacaacacccgaacaaagtg
cacaatgtgatgcagggcaaattcgcggcgaacatgttcttcgagaacagcacaagaact
cgcttttcgttcgaagtagcggagaaacgtctcggagcggaagtgctgaacttctcggct
gccgtatccagtgtgcagaagggcgaatcgatctacgacacggtccgcacgcttgaatcg
atgggtatcgacgtggggattatccggctcaagccaatcggcgttctcgccgagctggca
acaaaaattcaagtgccgcttattaacgctggcgacggcaataacgagcatccgacacag
gcgctgctcgacttatatacaatgcgcaagcatttcggcaatctgaacggtctgaccgta
tcgatcatcggtgacgttcttcacagccgcgtagcacgctccaatctatgggcgctacgc
aagtttggcgcaaaggttcaattctgctcgccaagcaacatgacggcaaccgatcttgat
gtaccgtacgtaacgatggatgaagcattgaaagccgacgttgttatgatgctccgcgtg
cagcttgagcgccatgagagcggcatgctgaactcggcagaagcataccgagagcaattc
ggcctgacggtcgagcgcgcaagccagatcgcagagcacgcaattatcatgcatcctgcc
ccaatcaaccgcggcgttgagattgacgacgagctggtagagcatccgcaatcacgcatt
ttcccgcaaatggcgaatggcgtaccgattcggatggcggttgtagaacgggcactgagc
taa

DBGET integrated database retrieval system