KEGG   Paenibacillus sp. JDR-2: Pjdr2_3901Help
Entry
Pjdr2_3901        CDS       T00977                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pjd01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pjd00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4449016..4449909)
Genome map
AA seq 297 aa AA seqDB search
MNKLTLLSVPFGLGAGTPGSEQAPRHIYQLGLFQMLQQQGCTINKLKEIINAGIPAPVIQ
VPMNHSEEVIKTGIALARAVKAVVSSGQFPFVLGGDHSLAMGTLAGLTSHYKKLGVIWID
AHADMNTESTSPSGNMHGIPLAVAQGRAQLSLSHLLPGAGTIAPGNIVLIGARDLDPAEE
AFIQAEGISCFRMDDIRRLGIHAVITEALRIAGDGADGIHLSFDIDSVDPAEAPGTGTPV
HGGLTADEAREAIRMLGISKRMTSAEFVEVNPLLDHLDQTSLLAMELIVLFLSSMKS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaataagcttactttgttatccgttccctttggtcttggcgcagggacacccggcagt
gagcaagccccccgccacatctatcagctgggcctttttcaaatgctgcagcagcaaggc
tgcacgattaataagctgaaggaaatcataaacgccggtattcctgctcccgttattcag
gttccgatgaaccattccgaggaagtcatcaagacgggaatcgcattggcccgggccgta
aaagccgttgtatcttccggacagtttcctttcgttcttggcggagatcatagtctggcg
atggggacgttagccggattgacctcgcattataagaagcttggcgtcatatggattgat
gcgcatgccgatatgaacaccgaatcaaccagcccttccggcaatatgcacggcatcccg
ctcgccgtcgcccaaggaagggcgcagctgtctttatcccacttattgccgggagcgggt
acaatcgctcccggcaatattgtccttatcggagcccgggatctggatcctgcggaggaa
gcgtttatccaggcggagggaatttcttgtttccgcatggacgacattagacggcttggc
attcatgcggtaatcaccgaagcgcttcgcattgcgggagacggggcggacggcatccat
ctcagctttgatatcgacagcgttgatcctgccgaagctccggggacgggtactccggta
catggcggtttaacagcggacgaagcccgggaggctatccgcatgctaggcatatccaaa
cgcatgacctccgccgagttcgtagaggtgaatccgctgcttgatcacttggatcaaacc
tctttgctggcaatggagctgatcgtgttgtttttgagcagtatgaagagttaa

DBGET integrated database retrieval system