KEGG   Paenibacillus sp. JDR-2: Pjdr2_3987Help
Entry
Pjdr2_3987        CDS       T00977                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Pjdr2_3987
Enzymes [BR:pjd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Pjdr2_3987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4529080..4529958)
Genome map
AA seq 292 aa AA seqDB search
MAKIIVVGSSSVDLVVTAARRPGAGETVLGEGFATVPGGKGANQAIAAARLGAEVTMIGR
VGDDVYGQEILNNFRMNNVFNGYVEPVTHMASGTAHIVLAEGDNSIVVVPAANNEVTPAF
IEKCKEAFHKADILLIQQEIPEETVAYVGELCKEMQLPLLLNPAPARPLTEELIANATYL
TPNEHEARVLFPGLSLSEALRRYPNKLFITEGSRGVRFFDGQQEVLVPSYKVEAVDTTGA
GDTFNAAFAVALAEGRPIRDCVKFANRAASLSVTKFGAQGGMPIRREVEEQM
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaataatagtagtcggaagttcatcggtcgacctcgtcgtaacggcggcgagg
cgtcccggggcaggagaaacggttctcggggaaggttttgccaccgttccgggaggcaag
ggggctaatcaggcgattgccgctgcgcgtctaggcgcagaagtaacgatgattggacgc
gtaggagacgatgtttacggtcaagaaattttaaacaattttagaatgaataatgttttt
aacggatatgtggaaccggttacacatatggcgagcggaactgcacatattgtactcgcg
gaaggcgacaatagtatcgttgttgttcctgcggcgaacaatgaagtgaccccggctttt
attgaaaaatgcaaggaagcgttccacaaagccgacatcctattaatccagcaggaaatt
ccggaggaaaccgtcgcatatgtaggtgaactttgcaaggaaatgcaattgccgctgctg
ctgaatcccgctccggctcgtccgctcacggaagagctgattgcgaatgcgacgtatttg
acgccaaacgagcatgaagcaagggttttgtttcccggccttagcttatccgaagcattg
cgccgttatccgaacaagctgtttatcacggaaggcagccggggagtgcgattctttgat
gggcaacaagaggtgctggttccttcctacaaggtcgaagccgtcgatacgaccggtgcg
ggagatacctttaacgccgcgtttgccgtcgcgctcgcggagggaaggccgattcgcgat
tgcgtgaagtttgctaaccgtgccgcttccctgtccgtcacgaaattcggcgcgcagggc
ggcatgccaatacggagagaagtagaggagcagatgtaa

DBGET integrated database retrieval system