KEGG   Paenibacillus sp. JDR-2: Pjdr2_4080Help
Entry
Pjdr2_4080        CDS       T00977                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pjd00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pjd00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:pjd00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4641502..4643805)
Genome map
AA seq 767 aa AA seqDB search
MRKYISLNGNWLFTKQQIPDAAARATDANGWEPVEVPHTWNAIDGANGFDFYKGACWYKR
EFSIDRSASGNRVFIEFKGSNSITDVYINGTYLGQHRGGYSTFRFDITEHVCFGEANMVS
VKVDNTVVDDVYPQMADFTFFGGIYRDVNLVIVNPVHIDMMDYGSQGVYVIQEQVSREQA
VLTIRTRMVNSLDSQKKVRLWADLVDADGRTEAYTAKEVVLAAGEALEVDMPLTVCQPTL
WNGRSNPYLYEARVSINSFNDTLDSLSIPVGIRYFEVDAEQGFFLNGESHPLRGVSRHQD
RKDMGWAISKREHEEDMALIKEVGANTIRLAHYQHDPYFYDLCDQEGMVLWAEIPFISVM
SKNELEGINAKQQMIELIRQNFNHPSICFWGIQNEIQISGERPELRRLVGELNELTKKED
PTRLTTMANVMFVPDNDDYNRVTDVVGYNKYYGWYQGKVEDFAVWIDGFRQTNPTVKLGI
SEYGAEGIVEYHNDDPQVKDYSEEYHALFHEKVWSIFHARPFLWSTYVWNMFDFGANIRD
EGGVKGRNNKGLVTYDRQIKKDAFYMYKANWSDEKFVHIAGKRYIDRPNESISIKAYSNC
DEVSLYVNGVQQQTLSSDNRIFIFDHLPLQEGLNTVRVISNANGMPVEDKAWFNRTNEPN
PSYEAPEDKGGIVSNWFQLPEEEDIEMEELIITDDVFSTRCTIREMMNHPEARLVAEKYL
GANFVDNPMYGMAEGMSMELIAGMASDVFTEKVMYRINKELTKISRT
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaatatataagtctcaacggaaattggctatttacgaagcagcagataccggac
gctgcagcccgcgcaacggatgcaaacggatgggaaccggtggaggttccccatacttgg
aacgcaatcgacggcgcaaacgggtttgatttttataagggcgcttgctggtataaaaga
gaattttcgatagaccgttccgcttcaggcaaccgcgtgtttatcgagttcaagggctcg
aacagtatcacggatgtgtatatcaacggtacttacttgggtcagcatcgcgggggttat
tcgactttccggtttgatattacggagcatgtatgcttcggggaagcgaatatggtgtct
gttaaggtggacaatacggttgttgacgatgtctacccgcagatggccgatttcaccttc
ttcggaggcatttaccgggatgtcaacctcgtgatcgtgaatcccgttcatattgacatg
atggattatggttcgcagggcgtatatgtgatccaagaacaagttagccgggaacaagcg
gtccttacgattcggacaagaatggtaaactcgcttgattcgcaaaagaaagtaagactt
tgggcagacctggttgatgcagacggacgtaccgaagcttatacggctaaggaagtcgtg
ctggcagcgggagaagcgcttgaggtggatatgccgctgaccgtttgtcagccgacatta
tggaatggccgcagcaatccgtatttatacgaagctcgagtctctattaattcctttaac
gatacattggattcgctttccattcccgtgggaattcgttatttcgaagtagacgcggaa
caaggcttcttcctgaacggcgaatcgcatcctctgcgcggggtatccaggcatcaggac
cgtaaagatatgggctgggctatttccaagcgagagcatgaggaggatatggcgcttatt
aaggaggttggagcgaacacgattcgtctggcgcattaccagcatgatccatacttctat
gatttatgcgatcaagaagggatggtcctctgggccgagattccttttatctccgtaatg
tccaagaatgagctggaaggcatcaacgcgaagcagcagatgattgaactgatccggcaa
aacttcaaccatccgtcgatttgcttctggggcatccagaatgaaatccagatcagcggc
gaacgtcccgagcttagaaggctggtaggcgagctgaacgaattgaccaagaaagaagat
ccgacgagattaacgacgatggccaacgtcatgttcgttccggataacgacgattataac
cgcgtcaccgacgttgtggggtacaacaaatattacggctggtaccaaggcaaggttgaa
gacttcgcagtctggatcgacgggttccgccaaacgaatccgactgtcaagctcggcata
tcggaatacggggcggagggcatcgttgaataccataacgacgacccgcaggtgaaggat
tactcggaggaataccatgctttattccatgagaaggtatggagcattttccatgcacgt
ccgttcctttggtcaacctatgtttggaatatgttcgactttggagccaacatccgcgac
gaaggcggcgtgaaggggcgcaacaataaaggccttgtgacgtatgaccgtcaaattaag
aaagacgccttctatatgtacaaagcgaactggtcggatgagaaattcgttcatattgcc
ggcaagcgttatattgaccgcccaaacgaatcgatttcgataaaagcatactccaactgc
gatgaagtatcgctttacgtaaacggcgttcagcagcagacgttatcatctgataatcgg
atctttattttcgatcatttgccgcttcaagaaggcttgaatacggtacgcgttatctcc
aatgctaacggcatgcccgtagaggacaaggcatggtttaaccggaccaacgaaccgaat
ccaagctatgaagcgccggaagacaaaggcggaatcgtaagcaactggttccagcttccc
gaagaggaagatatcgagatggaagagctgatcattacggacgatgtgttctctacccgc
tgcacgattagggaaatgatgaatcatccggaagcgagattagtcgcggagaaatatctg
ggcgctaatttcgtggacaaccccatgtatgggatggctgagggcatgtcgatggaattg
atagcaggcatggcttccgatgttttcacggaaaaagtgatgtaccgcatcaacaaagaa
ttgacgaaaatcagcagaacctga

DBGET integrated database retrieval system