KEGG   Paenibacillus sp. JDR-2: Pjdr2_4260Help
Entry
Pjdr2_4260        CDS       T00977                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
pjd  Paenibacillus sp. JDR-2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4882981..4883991)
Genome map
AA seq 336 aa AA seqDB search
MESTVNKQDKQSLAEAFQNDLLIGAAVNHRTIVSQSELLNQHYNSVTAENEMKFESLHPK
EHLYTFEQADKIAGFARENGMKLRGHTLVWHNQTPDWVFEDGHGGIAGRELLLARMKSHI
ETVVNRYKDTIYCWDVVNEAVTDDGEERLRPSKWLHGIGQDYIEQAFRFAHEADPDALLF
YNDYNECNPGKREKIYSLVKALLENGAPVHGIGLQAHWNLFDPSLDLIREAIERYASLGL
KLQITEMDVSMFAFDDRRTDLAAPTADMMRLQEERYKQFFGLFREYKDVLTSVTFWGAAD
DYTWLDHFPVRGRKNWPLLFDTEQRPKKVVKEIIGQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggagagtacagttaataagcaggataagcaatcgttagccgaagcattccaaaatgat
ttgttgattggtgcggcggttaatcatcgcacaatcgtcagccagagcgagctgttgaat
cagcactacaatagcgtaaccgctgagaatgaaatgaagtttgagagccttcatcctaag
gagcatctgtacaccttcgagcaagcagataagattgcgggcttcgcccgtgagaatggc
atgaagcttagaggccatacgctggtttggcataatcagacgccagactgggtgtttgag
gacggccatggaggaatagcaggccgtgagctgctgcttgcccggatgaagtctcacatc
gagacggttgtgaatcgatacaaggatacgatctactgctgggatgtcgtaaacgaagcc
gtgacggatgacggcgaagaaaggttgcgtccttccaaatggctgcatggcatcggacag
gattacatagagcaggcattccgctttgcccatgaagccgaccctgatgctctactgttt
tacaatgattacaatgaatgcaatcctggcaaaagagaaaagatttactccctcgtgaaa
gcgctgcttgagaacggggctcctgttcacggcatcggactccaggcgcattggaatctg
tttgatccgtctttggacttgatccgggaagctatcgaacgttatgcatcgcttggctta
aagctgcaaattaccgaaatggatgtatccatgtttgcctttgacgataggcgaaccgat
cttgcggcccctacggcagatatgatgcgactgcaggaagaaagatacaagcaatttttc
gggctgttccgcgaatataaggacgtactgaccagcgtcaccttctggggagcggcggat
gattatacctggctggatcactttccggtcagaggaaggaaaaactggccgcttctgttc
gatacggagcagcgtcccaaaaaagtggtcaaggagattattggacaatag

DBGET integrated database retrieval system