KEGG   Paenibacillus sp. JDR-2: Pjdr2_4264Help
Entry
Pjdr2_4264        CDS       T00977                                 

Definition
(GenBank) Alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00052  Galactose metabolism
pjd00561  Glycerolipid metabolism
pjd00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Pjdr2_4264
  Lipid metabolism
   00561 Glycerolipid metabolism
    Pjdr2_4264
   00600 Sphingolipid metabolism
    Pjdr2_4264
Enzymes [BR:pjd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Pjdr2_4264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase_2 Melibiase Glyco_hydro_97 Raffinose_syn
Motif
Other DBs
NCBI-ProteinID: ACT02888
JGI: Pjdr2_4264
UniProt: C6D785
Position
4888578..4889738
Genome map
AA seq 386 aa AA seqDB search
MDKPLGITPAMGWNSWNTFTWDINEQLIRDVADRFESDGYQAAGYEYIVIDDCWSLKQRD
QQRNLVADPAKFPSGMKALADYIHSKGLKFGMYSCVGTHTCAGFPGSFEHEFQDAQLFAE
WGVDYLKYDYCFKPRHISGELLYKRMSLALKNSGRDILLSACNWGEDNVYQWIRESGAHM
YRSTGDIQDHWDSIKNLALSQLDKECYTGSFCHNDLDMLVVGMYGGSNNTFIGSKIGGCS
DNEYKTHFSLWCLMGSPLMIGCDIRTANPETTNILLNPDLIAINQDMESRGAYRIKPEPQ
WFHADDVFMLVKVLTDGDVAIGFFNLSDNQRELSLQFWDIGLPYASGFSLLLYDCWEHKE
LGMFKERFAPVVPAHDCLIVRAKLVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
ttggataagcctcttggcataactcccgctatgggatggaattcatggaacacttttacc
tgggacatcaatgaacagttgatccgggatgttgccgaccgattcgaatcggatggatac
caagcagcaggttatgaatatatcgtcattgatgattgctggagtctgaagcagcgtgat
cagcagaggaatcttgttgctgatccagccaaatttccaagcgggatgaaagcactcgcc
gattatatccactcgaaaggcttgaaattcgggatgtattcatgcgttggcacccatacc
tgtgcaggctttcccggcagctttgagcatgaatttcaagatgcccaattattcgctgag
tggggcgtcgattatttgaagtatgattattgcttcaaaccccggcatatctcgggagag
ttgctgtacaagcgaatgagccttgcccttaaaaacagcggacgggacattcttttatct
gcctgcaactggggcgaggataatgtctaccagtggatacgtgagtcaggtgcccatatg
taccggtcaacaggcgatattcaagatcactgggattccattaaaaatctggccctatca
cagctggacaaggaatgttataccggatccttctgccataatgatctggatatgctggtt
gtcggcatgtacggaggcagcaataacacgtttatcggcagtaaaataggcggctgcagc
gacaatgaatacaagactcatttctcattatggtgcttaatgggttctccgcttatgatt
ggctgcgatatccgtaccgctaatccggagaccacaaatattttgctcaacccggatctg
atcgctatcaatcaggatatggaaagccgcggagcctaccggattaagccggagccccaa
tggttccatgctgatgatgtctttatgctggtaaaagtactgacggacggcgacgtggct
atcggcttcttcaatctaagcgataatcagcgggagctgtcgctgcaattttgggatatc
ggtcttccttacgcttccggcttctccttattgctgtatgactgctgggagcataaggag
cttggcatgttcaaagagcggttcgctcccgttgtgcctgcgcatgactgcctgattgtc
cgtgccaagctggttaaataa

DBGET integrated database retrieval system