KEGG   Paenibacillus sp. JDR-2: Pjdr2_4673Help
Entry
Pjdr2_4673        CDS       T00977                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pjd01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pjd00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pjd00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pjd00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:pjd00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5355666..5357243
Genome map
AA seq 525 aa AA seqDB search
MNFDQWIAPEQYNISSEIERHKSDKLALRLLDDQGHTTHITYNDLLNQVNQLAGGLNELG
LAKGDRVLVMVPRTIEAYMIYVACLKLGLVIIPSSEMLRAKDLSYRLQHSEARAVIAWAE
GAAEVDNITEELPELQFRIDASGGQADGWITLGSLMEGQPEEREAEATHRDDMAILAYTS
GTTGNPKGVVHSHGWGYAHLRITAAWLGIQSSDLVWATAAPGWQKWIWTPFLSVLGSGAT
GLIYNGSFSAERYLRIIQENQVQVMCCTPTEYRIMAKTDGLSGYDLSSIRSAVSAGEPLN
QAVIKQFEELFGFIIRDGYGQTENTLLIGNLKDSPIKIGSMGKSIVPGLVEIIDDEGRPQ
PMGEVGSIAVHTDMPALFKSYYKDPDRKGDNIVGSYFITGDRASKDEEGYLWFEGRGDDI
IISSGYTIGPFEVEEALLRHPSVKECAAVASPDEIRGHIVKAFIVLRDGVSGSPELVQEL
QDHVKSVTAPYKYPRKIEFVSELPKTNSGKIRRIELRQREAFLNS
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgatcaatggatcgcacccgaacaatataacatcagctctgagattgagcgc
cacaagtcggacaagcttgcgctccgcttgctggacgatcaggggcataccacgcacatt
acatataacgacctgctgaatcaagtaaaccagctggcgggcggcttgaacgaactaggc
ctggcaaaaggcgatcgcgtcctcgttatggttccaagaaccatcgaagcgtatatgatt
tacgtagcctgcttgaagcttggccttgtcattattccatcctccgaaatgctccgggcg
aaggatctgtcctaccgcctccagcattccgaagcgcgtgcggttatcgcatgggcagaa
ggtgccgctgaagtagacaacattacggaagaactgccagagctgcagttccggattgat
gctagcggcggacaagcggatggttggatcaccctcggctccttaatggaaggacagccg
gaagagcgcgaagccgaggctacccatcgcgatgatatggcgattctcgcttatacgtcg
gggacaaccggcaatccaaaaggcgtcgttcacagccacggctggggctacgcgcatctg
cgcatcaccgctgcatggcttggcatccaaagctccgatctggtctgggcaaccgctgcg
ccaggctggcaaaaatggatctggacgccgttcttatccgtgctgggcagcggcgcaacc
ggcttgatctataacggttcgttcagtgcggaacgttacttgcggatcattcaggaaaac
caggttcaagtgatgtgctgcacgccaaccgaataccgcatcatggcgaagacggatggc
ttatccggttacgacctgtcgtcgatccgcagcgcggtatcggccggcgagccgcttaac
caagccgtgatcaagcagttcgaggagctgttcggcttcatcatccgcgacggctacggc
cagacggaaaatacgctgctgatcggcaatctgaaggattcgcctattaagattggctcc
atgggcaagtctatcgttccgggtctcgtcgagattattgatgacgaaggccgtccgcag
ccgatgggagaggtcggcagcattgccgttcataccgatatgcctgccctgttcaagtca
tattacaaggatcccgatcgcaaaggcgacaacattgttggttcgtacttcatcaccggc
gaccgcgcaagcaaggatgaggaaggttatctctggttcgaaggccgcggggacgatatc
attatcagctccggctatacgattggaccctttgaggtcgaagaagccttgctccgccat
ccatctgttaaagaatgtgcagccgtcgcaagcccggacgaaatccgcggccatatcgtg
aaggcttttatcgtcctgagggacggcgtctccggttccccggagctggtccaagagctg
caggatcacgtcaaatccgtaacggcgccttacaaatatccgcgtaaaatcgaattcgta
agcgagctgccgaaaaccaactccggtaaaatccgccggatcgagcttcgccaacgcgag
gcgtttctgaactcttaa

DBGET integrated database retrieval system