KEGG   Paenibacillus sp. JDR-2: Pjdr2_4673Help
Entry
Pjdr2_4673        CDS       T00977                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00010  Glycolysis / Gluconeogenesis
pjd00620  Pyruvate metabolism
pjd00640  Propanoate metabolism
pjd00680  Methane metabolism
pjd01100  Metabolic pathways
pjd01110  Biosynthesis of secondary metabolites
pjd01120  Microbial metabolism in diverse environments
pjd01130  Biosynthesis of antibiotics
pjd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pjdr2_4673
   00620 Pyruvate metabolism
    Pjdr2_4673
   00640 Propanoate metabolism
    Pjdr2_4673
  Energy metabolism
   00680 Methane metabolism
    Pjdr2_4673
Enzymes [BR:pjd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Pjdr2_4673
Lipid biosynthesis proteins [BR:pjd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pjdr2_4673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACT03287
JGI: Pjdr2_4673
UniProt: C6CYZ5
Position
5355666..5357243
Genome map
AA seq 525 aa AA seqDB search
MNFDQWIAPEQYNISSEIERHKSDKLALRLLDDQGHTTHITYNDLLNQVNQLAGGLNELG
LAKGDRVLVMVPRTIEAYMIYVACLKLGLVIIPSSEMLRAKDLSYRLQHSEARAVIAWAE
GAAEVDNITEELPELQFRIDASGGQADGWITLGSLMEGQPEEREAEATHRDDMAILAYTS
GTTGNPKGVVHSHGWGYAHLRITAAWLGIQSSDLVWATAAPGWQKWIWTPFLSVLGSGAT
GLIYNGSFSAERYLRIIQENQVQVMCCTPTEYRIMAKTDGLSGYDLSSIRSAVSAGEPLN
QAVIKQFEELFGFIIRDGYGQTENTLLIGNLKDSPIKIGSMGKSIVPGLVEIIDDEGRPQ
PMGEVGSIAVHTDMPALFKSYYKDPDRKGDNIVGSYFITGDRASKDEEGYLWFEGRGDDI
IISSGYTIGPFEVEEALLRHPSVKECAAVASPDEIRGHIVKAFIVLRDGVSGSPELVQEL
QDHVKSVTAPYKYPRKIEFVSELPKTNSGKIRRIELRQREAFLNS
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgatcaatggatcgcacccgaacaatataacatcagctctgagattgagcgc
cacaagtcggacaagcttgcgctccgcttgctggacgatcaggggcataccacgcacatt
acatataacgacctgctgaatcaagtaaaccagctggcgggcggcttgaacgaactaggc
ctggcaaaaggcgatcgcgtcctcgttatggttccaagaaccatcgaagcgtatatgatt
tacgtagcctgcttgaagcttggccttgtcattattccatcctccgaaatgctccgggcg
aaggatctgtcctaccgcctccagcattccgaagcgcgtgcggttatcgcatgggcagaa
ggtgccgctgaagtagacaacattacggaagaactgccagagctgcagttccggattgat
gctagcggcggacaagcggatggttggatcaccctcggctccttaatggaaggacagccg
gaagagcgcgaagccgaggctacccatcgcgatgatatggcgattctcgcttatacgtcg
gggacaaccggcaatccaaaaggcgtcgttcacagccacggctggggctacgcgcatctg
cgcatcaccgctgcatggcttggcatccaaagctccgatctggtctgggcaaccgctgcg
ccaggctggcaaaaatggatctggacgccgttcttatccgtgctgggcagcggcgcaacc
ggcttgatctataacggttcgttcagtgcggaacgttacttgcggatcattcaggaaaac
caggttcaagtgatgtgctgcacgccaaccgaataccgcatcatggcgaagacggatggc
ttatccggttacgacctgtcgtcgatccgcagcgcggtatcggccggcgagccgcttaac
caagccgtgatcaagcagttcgaggagctgttcggcttcatcatccgcgacggctacggc
cagacggaaaatacgctgctgatcggcaatctgaaggattcgcctattaagattggctcc
atgggcaagtctatcgttccgggtctcgtcgagattattgatgacgaaggccgtccgcag
ccgatgggagaggtcggcagcattgccgttcataccgatatgcctgccctgttcaagtca
tattacaaggatcccgatcgcaaaggcgacaacattgttggttcgtacttcatcaccggc
gaccgcgcaagcaaggatgaggaaggttatctctggttcgaaggccgcggggacgatatc
attatcagctccggctatacgattggaccctttgaggtcgaagaagccttgctccgccat
ccatctgttaaagaatgtgcagccgtcgcaagcccggacgaaatccgcggccatatcgtg
aaggcttttatcgtcctgagggacggcgtctccggttccccggagctggtccaagagctg
caggatcacgtcaaatccgtaacggcgccttacaaatatccgcgtaaaatcgaattcgta
agcgagctgccgaaaaccaactccggtaaaatccgccggatcgagcttcgccaacgcgag
gcgtttctgaactcttaa

DBGET integrated database retrieval system