KEGG   Paenibacillus sp. JDR-2: Pjdr2_4714Help
Entry
Pjdr2_4714        CDS       T00977                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00260  Glycine, serine and threonine metabolism
pjd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pjd01100  Metabolic pathways
pjd01110  Biosynthesis of secondary metabolites
pjd01130  Biosynthesis of antibiotics
pjd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pjdr2_4714
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pjdr2_4714
Enzymes [BR:pjd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pjdr2_4714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACT03328
JGI: Pjdr2_4714
UniProt: C6CZ36
Position
5416438..5417601
Genome map
AA seq 387 aa AA seqDB search
MSQEQVAEGYFGEFGGSFVPPELKEVLDYLSAQFNKFKDDPEFKEELDYYLKEYVGRENP
LTYAEQLTNAWGGAKIYLKREDLNHTGAHKINNVVGQILLAKRMGAKRVIAETGAGQHGV
ATATACAMFNMDCVIYMGAEDTRRQALNVFRMELLGATVVPVDKGQGRLKDAVDEALNDL
VANYQNTFYLLGSAVGPHPFPTMVKHFQSIISEESKRQILAKEGRLPDAVIACAGGGSNA
IGAFAHYIDEPSVRLIGVEPDQAPTLTEGVPGIIHGFKCLVLLDEEGNPRKTYSIAAGLD
YPGIGPEHSHLKVTGRAEYVTVSNEEVLAAFQELSRTEGIIPALESAHAVAHAKKLAPTM
NKDEIIIINLSGRGDKDVEQVFHMLHK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagaacaagtagctgaagggtattttggagaatttggcggcagctttgtcccg
cctgagctgaaggaagtattggactacttaagcgcgcaattcaacaagttcaaggatgat
ccggaatttaaggaagaactggactattatctgaaggaatatgtcggccgcgaaaacccg
ctgacttacgccgaacagctgacgaacgcctggggcggcgcaaaaatctatctgaaacgc
gaggacttgaaccataccggcgcacacaaaatcaataacgtggttggccaaatcctgctc
gccaaacggatgggcgctaaacgcgtcattgccgagaccggtgccggtcagcatggcgtt
gctacagcaaccgcttgcgcgatgtttaacatggactgcgtcatctatatgggcgcggag
gatacacgccggcaggcgctgaacgtattccggatggagctgcttggcgctaccgttgta
ccggtagacaaaggtcaaggccgcctgaaggatgccgttgacgaagcgctgaacgatctg
gttgccaactatcaaaacacgttctacctcctgggttcggccgtaggcccgcatccgttc
ccaacgatggttaagcacttccaatcgatcatcagcgaagaatcgaagcgtcagatactg
gccaaggaaggccgtctcccggatgccgttatcgcctgcgctggcggcggcagcaatgcg
attggagctttcgcccactacatcgacgagccttccgtacgcctgatcggcgttgaaccg
gatcaagcgccaaccttgaccgaaggcgttcctggcatcatccacggcttcaaatgtctc
gtgctgcttgatgaagaaggcaatccaagaaaaacgtactctatcgcagctggtcttgat
tatccgggtatcggaccggagcacagccatctgaaggttaccgggcgcgcggaatacgtt
acggtaagcaatgaagaagtgctcgcagcgttccaggagctgtcccgtacggagggcatt
atccccgcgcttgaaagcgcccatgcggttgcccacgcgaaaaagctcgctccaacgatg
aacaaggacgagatcatcattatcaatctgtccggccgcggcgataaagacgtggagcaa
gtgttccacatgcttcataaataa

DBGET integrated database retrieval system