KEGG   Paenibacillus sp. JDR-2: Pjdr2_4725Help
Entry
Pjdr2_4725        CDS       T00977                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pjdr2_4725
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pjdr2_4725
  Amino acid metabolism
   00310 Lysine degradation
    Pjdr2_4725
Enzymes [BR:pjd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Pjdr2_4725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5431262..5432488
Genome map
AA seq 408 aa AA seqDB search
MQQIIVPAMGESITEGTISKWVVKVGDAVKQGDVLLELETDKVNIEISAEQDGVLQEIAK
NEGDTVEIGEVIGTIGAGSGAAAPAPAAPAAEAAPAPAAAPAAAPATAVAVAPAPAADSH
LNASPAARKLAREKGIDISEAQSTLGRVELRPAAPAPAAAPAPAAKAAQPEFTSNKPFTR
TKMSRRRATIANRLVEAQHTAAMLTTFNEVDMTAIMDVRKRRKQSFLDKHEVGLGFMSFF
TKAVVGALKEFPNLNAEINNGDIIAKQYYDIGIAVSAKEGLVVPVVRDADRLSFAEIEKS
IVSLAKKARDNSLALDELQGGTFTITNGGTFGSLLSTPILNAPQVGILGMHKIQLRPVAI
DAERSENRPMMYIALTYDHRIVDGSEAVRFLVKVKEMLEDPETLLLEG
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacaaattatagttccggcaatgggtgaatcgattacggagggcacaatctccaaa
tgggtcgttaaagtaggagacgctgttaaacaaggcgacgtgcttcttgagcttgaaaca
gacaaagtaaacatcgaaatcagcgctgagcaagacggcgttctgcaagaaatcgcaaaa
aacgaaggcgacaccgttgaaatcggtgaagttatcggcacaatcggagctggcagcggc
gctgccgctccggcaccggctgctccagcagctgaagcagcgcctgcaccggcagcagct
ccggctgctgctccggctacagcggtagccgttgctccggcacctgcggctgacagccac
ctgaatgcttctcctgcagcccgcaagcttgcaagagaaaaaggcatcgacatcagcgaa
gcacaatcgacgcttggacgcgttgagcttcgccctgcggctcctgctcctgcagcagca
ccggcgccagctgcaaaagcggctcaaccggaattcacgtcgaacaagcctttcactcgc
accaaaatgtcccgccgccgcgcgacaatcgctaaccgcctcgttgaagcacagcataca
gcagctatgctgactacgttcaacgaagttgatatgacagcgatcatggacgttcgtaaa
cgccgtaagcaatcgttcctggacaaacacgaagttggtcttggcttcatgtccttcttt
actaaagcagttgttggcgcattgaaagagttccctaatttgaatgctgaaatcaacaac
ggcgatatcatcgccaaacaatattacgatatcggcatcgccgtatcggccaaagaaggt
ctggttgttccggtcgttcgcgacgcggaccgcctgagcttcgcggaaatcgagaaatcg
atcgtatccctggctaaaaaagcgcgcgacaactcgctggcgctggatgagctgcaaggc
ggtacattcactatcactaacggtggtacattcggatcgctcttgtcgacaccaatcctg
aacgctccgcaagtcggcattctgggtatgcacaaaatccagcttcgtccggtagcgatt
gacgctgaacgttcggagaaccgtccgatgatgtacatcgccctcacttacgatcaccgt
atcgttgacggctcagaagcggttcgcttccttgtaaaagtaaaagaaatgcttgaagat
ccggaaactctccttttggagggctaa

DBGET integrated database retrieval system