KEGG   Paenibacillus sp. JDR-2: Pjdr2_4994Help
Entry
Pjdr2_4994        CDS       T00977                                 

Definition
(GenBank) capsular exopolysaccharide family
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_31 CbiA ParA CBP_BcsQ Fer4_NifH MipZ SRP54 ArsA_ATPase AAA_26 VirC1 CLP1_P AAA_30 PTPlike_phytase DUF853 Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: ACT03605
JGI: Pjdr2_4994
UniProt: C6D0K6
Position
complement(5709611..5710309)
Genome map
AA seq 232 aa AA seqDB search
MQQSIMENSKLITTSNPDSPIAEAYRSLRTNIQFSSIDVPVKTLMVTSCQSGDGKTTTIA
NLAVAFSQEGKRVLLVDADLRRPTLHTVFMLSNQTGLTNVLANQTEWQDAVHSTSVDNLF
FIGSGPTPPNPSEMLGSKKMNQLIEELSAHYDMILFDAPPSLVVTDGLVLASKCDGVVAV
ISVGMTKRQQAKKLYASLEHVKAKLLGVVLNNKKKKSKEQLYYTYYGTNRRM
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaatccataatggaaaatagcaagctgattacgacgagcaatcccgattcccct
attgctgaggcgtaccgttctttgcgtacgaatattcaattttcttctattgatgtacct
gtgaagacgttaatggttacgtcctgtcagtccggtgacggcaaaacaacaacgattgcg
aaccttgcggttgctttctcccaagaaggcaagcgtgtacttctggttgatgcggatttg
agacggccaacccttcatacggtttttatgctgtccaatcagactggcctgacgaatgtg
ttggctaatcagacggaatggcaggatgccgtgcattcaacctcggttgataatttattt
tttatcggttccggtcctactccgcctaatccttcggaaatgctgggctccaaaaaaatg
aatcagcttatcgaagagctgtccgcccattacgatatgatcctttttgatgctccgcca
tcactcgttgtaactgacgggcttgtgcttgcttccaaatgcgatggcgtagttgccgta
atcagcgttggaatgaccaagcgccagcaagcgaaaaaattgtacgccagtcttgagcat
gtgaaagcgaagctgcttggagtggtgctcaacaataagaaaaagaaaagcaaggaacag
ctgtattacacctattacggtacaaacaggaggatgtaa

DBGET integrated database retrieval system