KEGG   Paenibacillus sp. JDR-2: Pjdr2_5006Help
Entry
Pjdr2_5006        CDS       T00977                                 

Definition
(GenBank) cation diffusion facilitator family transporter
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cation_efflux ZT_dimer
Motif
Other DBs
NCBI-ProteinID: ACT03617
JGI: Pjdr2_5006
UniProt: C6D0L8
Position
complement(5726120..5727016)
Genome map
AA seq 298 aa AA seqDB search
MNQYEEIKQGEKGALVSIGAYIGLSAIKLGAGYWFASGALVADGFNNLTDIIASVAVLVG
LRISQKPPDKDHPYGHFRAETIAALIASFIMATVGLQVIINTVRSLFAGGQTVPSLTSAW
VALFAAACMGAVYFYNRRLANRINNQALHAAAKDNLSDTLVSIGAAVGIIGAQFGLPWLD
PVAALAVGAIICKTAWDIFYSSTHALTDGFDANELMTLRSTIERTKGVKSIKDIKARVHG
SNVLIDVIVQVDPGLTLIESHRISDEIEQQMEGKHNIMSVHVHVEPHEEPLSSPSPLH
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagtatgaagagatcaagcagggcgagaaaggagccttggtcagcatcggggct
tatatcgggctgtcggctatcaagctaggcgccggctattggtttgcctctggagcgctc
gttgcggacggctttaataacctgacggatattattgcttcggttgctgtgctggtaggt
ctccgcatctctcagaagccgcccgacaaggatcacccttacggacatttcagggcagag
acgattgcggcgcttattgcttcgtttataatggcgacggtaggcctgcaggtgattatc
aatacggtacgttctttattcgcaggagggcagaccgtgccttcgctgacttcagcatgg
gttgctttgttcgcggcagcctgtatgggtgccgtatatttctataaccgcaggttggct
aaccggattaataaccaggctttgcatgcggcggcaaaagataatctatctgacacgctt
gtcagtatcggcgcagcggttggaattatcggcgctcagtttggcctgccttggctggat
ccggtggccgcacttgcggttggcgccattatatgcaaaaccgcctgggacattttctac
agctcgacccatgctctgacggatggctttgatgccaacgagctgatgacgctgcgttcc
actatcgagcggacgaaaggcgtcaaatccattaaagacataaaggcccgcgtacacggg
agcaatgtgctcatcgatgtgatcgtgcaggttgatcccggtttgacgcttattgaaagt
catcggatcagcgatgagattgagcagcagatggaaggcaaacataatattatgagcgtc
catgttcatgtggagccgcatgaggagcccttatccagtcctagtcctctgcattaa

DBGET integrated database retrieval system