KEGG   Paenibacillus sp. JDR-2: Pjdr2_5007Help
Entry
Pjdr2_5007        CDS       T00977                                 

Definition
(GenBank) ABC transporter related
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_tran_Xtn AAA_21 SMC_N AAA_29 RsgA_GTPase KAP_NTPase MMR_HSR1 ATP-synt_ab AAA_15 AAA_23
Motif
Other DBs
NCBI-ProteinID: ACT03618
JGI: Pjdr2_5007
UniProt: C6D0L9
Position
complement(5727189..5728808)
Genome map
AA seq 539 aa AA seqDB search
MISTSGITLRFGKKPLFEDVNIKFTPGNCYGLIGANGAGKSTFLKILSGEVEQSSGEVHI
TPGERLAVLKQNHFEYDEFNVLETVIMGHKKLYDVMKEKDALYAKADFTDEDGMRAGELE
AEFADMNGWEAESQAAEMLNGLGITPDLHDKKMAELGGNEKVRVLLAQALFGEPNILLLD
EPTNHLDIESIRWLEDFLSGYEGTVVVVSHDRHFLNTVCTHIADIDFGKIQMYVGNYDFW
YESSQLALALQRGENKKKEDKIKELQAFIQRFSANKSKSKQATSRKKLLDKITLDDIRPS
NRKYPFIHFKGEREAGKSLLLVEGLTKTIDGEKVIDNLTIAVNKGDKIAFVGPNGLPKTV
LFQLLMGELEADAGTFQWGVTTTQGYFPKDNAPYFDGVELNLVEWLRQYSKDPDETFIRG
FLGRMLFSGDDAIKKASVLSGGEKVRCMLSKIMLSGANVFVLDEPTNHLDLESITALNNG
LTDTDCTVLFTSHDHQFVQTIANRIMEITPNGLIDRMMSYDEYLESEEIKALRERMYAV
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgattagtacaagcggcataacgcttcgcttcgggaagaagccactattcgaagatgta
aatattaaatttacgcctggcaactgctatggcttgattggcgcgaatggcgcaggtaaa
tcgacgtttctgaaaattttgtccggcgaggttgaacagtccagcggggaagttcatatt
acgccgggcgaacgccttgcggtactcaagcagaaccatttcgaatacgatgagttcaac
gtcctcgaaacggttattatgggtcacaagaaactgtatgacgtaatgaaagagaaggac
gccctttacgcgaaagctgacttcaccgacgaagacggcatgcgcgcaggcgaactggaa
gctgaattcgcggatatgaacggctgggaagcggaatcgcaagcggctgagatgctgaac
ggccttggcattacgccggatctgcacgacaagaaaatggcggagctgggcggcaacgag
aaagtacgcgtcttgcttgcgcaagcgttgttcggcgaaccgaacatccttctcctcgac
gagcctaccaaccatttggacattgaatcgatccgttggctggaagatttcctgtccggc
tatgaaggcaccgtagtggtagtcagccatgaccgtcacttcctgaataccgtatgtacg
cacattgcggatatcgactttggcaaaatccagatgtacgtgggcaactatgacttctgg
tacgaatccagtcagctggctctcgcgctccaacgcggcgagaacaagaagaaagaagat
aagattaaagagcttcaagcgtttattcaacgcttcagtgcgaataaatcgaagtccaag
caagcgacttcccgtaaaaaattgctggacaaaattacgctcgacgacattcgtccgtcg
aaccgcaaatatccgtttatccatttcaaaggcgaacgcgaagcgggcaaatccttgctg
cttgttgaaggtctgacgaagacgatcgacggtgagaaggttattgataacctgacgatt
gcggtcaacaaaggcgacaaaatcgcttttgtaggacctaacggccttccgaagacggtt
ctgttccaattgctgatgggcgaattggaagcagatgccggtacgttccaatggggggtt
acaacaacgcaaggctacttcccgaaagacaacgcgccttacttcgacggcgttgagctg
aaccttgtggaatggcttcgccaatactccaaggatccggacgaaacgtttatccgcggc
ttcctgggtagaatgctcttctccggcgacgatgcgatcaagaaagcatcggttctgtcc
ggtggcgagaaagtgcgctgcatgctttccaaaatcatgctgagcggcgcaaacgtgttt
gttctcgacgagcctacgaaccatttggaccttgagtccattacagcgcttaacaacggt
ctgaccgatacggactgcacggttctgtttacatcgcatgaccatcagtttgtgcaaacc
attgcgaaccgtatcatggagattacgccgaacggcttgatcgacagaatgatgtcttat
gacgagtacctcgagagcgaagagattaaagctctccgcgagcgtatgtacgcggtataa

DBGET integrated database retrieval system