KEGG   Paenibacillus sp. JDR-2: Pjdr2_5021Help
Entry
Pjdr2_5021        CDS       T00977                                 

Definition
(GenBank) transcriptional regulator, MarR family
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR HTH_27 TrmB MarR_2 HTH_Crp_2 GntR HTH_24 HTH_11 Fe_dep_repress DUF4423 HTH_36 PelD_GGDEF PadR PNPase HTH_AsnC-type
Motif
Other DBs
NCBI-ProteinID: ACT03632
JGI: Pjdr2_5021
UniProt: C6D0N3
Position
complement(5746510..5746962)
Genome map
AA seq 150 aa AA seqDB search
MREILREVGMIARALDSISNIEFKELELTKGQYLYLVRIFEHPGIIQEKLAEMIKVDRTT
AARAIQKLEIQGFIEKKDDESNKKIKRLFTTEKGKLAYPFLKREGDHSNSVALAGITEEE
AEKLFHLLQRVRRNIEVEWDYVKKGNKRDY
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgagggagatacttcgtgaggttggcatgatcgcgagggcattagattccataagcaat
atcgaattcaaggagcttgagcttaccaaaggacaatacctgtatctggttcgcatcttt
gagcatccgggaattattcaggagaagctggcggaaatgatcaaggtggaccggacgacg
gctgcgcgcgcgattcagaagcttgagattcaaggctttatcgagaagaaagacgatgaa
tcaaacaagaagatcaaaaggctctttaccacggagaaaggcaagctggcttatcctttt
ttgaagcgggaaggggatcattcgaactctgtggcactggcgggaataacggaggaggaa
gcggagaagctttttcacctgctgcaaagggtcagaaggaatattgaggtcgagtgggat
tacgtgaaaaaggggaataaaagagactattaa

DBGET integrated database retrieval system