KEGG   Paenibacillus sp. JDR-2: Pjdr2_5030Help
Entry
Pjdr2_5030        CDS       T00977                                 

Definition
(GenBank) glycoside hydrolase family 76
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_76 Glyco_hydro_88
Motif
Other DBs
NCBI-ProteinID: ACT03641
JGI: Pjdr2_5030
UniProt: C6D0P2
Position
complement(5755373..5756431)
Genome map
AA seq 352 aa AA seqDB search
MATQGKWAERAAIAQEDFRRLFWNEERGVMDQVVPCNGTCNDHWIYWWHAHVVDVLVDSL
ERTKSEEDEVLLERAFRGAKKWNGDTLLHNYYDDMEWMALGLLRAYRATGKSFYKEGALE
LWEDIKTAWNDHMGGGMAWKKDQLDYKNTPANAPASILAARIYRMDRREEDLEWAKRIYQ
FNKERLVDPETGFVWDGMNRLGDGQIDYDWKYTYCQGVFIGAGIELYNCTGDESYLVDAQ
RTAGATVQELVDPETGMLPREGNDDCGLFKGILIRYLVNLIRIQPDLSLPWVNLIRHNAG
SLWEKGRSEAGLFSLSWAGEPEPEVQLSGQLSGVMLLEAMAELERDGFLAPR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcgacacaagggaaatgggcagaacgcgcggcaatcgcgcaggaggattttcgccgt
ctgttctggaatgaagagcgcggcgtgatggatcaggtggtgccttgcaacggcacttgc
aatgaccattggatttattggtggcatgcgcatgtggtagacgtattggtagattccctg
gaacgcacaaagtcggaagaggacgaagtgctgctggagcgggcattccgcggggcaaag
aagtggaacggcgatacgctgcttcataactattacgacgatatggaatggatggcgctt
gggctgctcagagcttatcgtgcgacagggaagtccttttacaaggaaggcgctcttgag
ctgtgggaagatatcaagacggcgtggaacgatcatatgggcggcggcatggcctggaag
aaggatcagctggactacaaaaacacgcctgcgaatgccccggcctccattctggctgcg
cgcatctatcggatggaccgccgtgaagaagacttggaatgggcgaagcggatctatcaa
ttcaacaaggaacggcttgtggatccggagaccggctttgtctgggacggcatgaaccgg
cttggcgacggccagatcgattacgattggaagtatacgtattgccagggcgtctttatc
ggagcgggcattgaactgtacaactgcacgggggatgaaagctatctcgttgatgcgcag
cgaaccgcgggggcaaccgtccaggaactggtcgatccggagacgggcatgctgccgcgc
gaggggaacgacgactgcggcctgttcaaaggcattctgatccgttatctggttaacctc
atccgtattcagcctgatttgtcgctgccatgggtcaatctgatccggcataacgcgggc
tccttgtgggagaagggtcgctcggaagccggcttgttcagcttatcctgggcaggagag
ccggagccggaagttcaactgagcggccagcttagcggcgtgatgcttcttgaggcaatg
gctgagctggagagagacggcttcctcgcgcctaggtag

DBGET integrated database retrieval system