KEGG   Paenibacillus sp. JDR-2: Pjdr2_5036Help
Entry
Pjdr2_5036        CDS       T00977                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09704  uncharacterized protein
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_125
Motif
Other DBs
NCBI-ProteinID: ACT03647
JGI: Pjdr2_5036
UniProt: C6D119
Position
complement(5762050..5763345)
Genome map
AA seq 431 aa AA seqDB search
MTQSTEIPASLTRLVERIKEKTADHPNWAAIFEKAIHNTLQTTIQRLPDGTTFVITGDIP
AMWLRDSAAQLRPFLVLASEDAELADLIEGLVRRQMDSILLDPYANAFNNGPTGKGHQDD
LTEMGPSIWERKYEIDSLCYPLQLSYLLWKNTGRTSQFGDTFRQAADAILNLWTTEQQHE
SVSPYRFQRFNCAPTDTLLREGKGTETAYTGMTWSGFRPSDDACTYGYLVPANMFAVVVL
GYLKEIAEEVLGDQELAARAAKLGGELHQGIQTYAVTDHPEFGKIYAYETDGLGNYNFMD
DANVPSLLSIPYLGYTSQEDPIYRNTRDFVLSSSNPYYFEGEAAAGIGSPHTPDRYIWHI
ALAMQGLTTDDRAEKERLLGLMEATTAGTGFMHEGFHADDPYQFSRPWFSWANMMFSELL
LDYCGIRVQTK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatcgacagaaattcccgcatccttaacgcgactagtggagcgtatcaaggaa
aagacagcggatcatccgaattgggcggcgatattcgagaaggccattcacaatacgctg
caaacgacgatccagcgcctgcctgacggcacgacatttgttataacaggtgatatacca
gctatgtggcttcgcgattccgctgcgcagcttcgtccgttcctggtgctggcgtccgag
gatgccgagctggccgatctgattgaaggtctagtccggaggcaaatggattcgatcctg
cttgatccttacgcgaatgccttcaacaacgggccaaccggcaaaggacatcaggatgat
ctgacggagatgggaccatccatctgggaacgcaaatacgagatcgattcgctttgctac
ccgctgcagctcagctacctgctctggaagaatacaggcagaacctcgcaatttggcgac
accttccgccaagccgcggatgcgatactgaatctctggacaacggagcagcagcatgag
agcgtatcgccttaccgcttccagcgcttcaattgcgcgccgacggatacgctgctgcgc
gagggcaaaggcacggagaccgcgtataccggcatgacatggagcggcttccgcccaagc
gatgatgcttgtacatacggttacctggtgccggctaacatgtttgcggttgtcgttctt
ggttatctgaaggaaattgcggaggaagtgcttggcgatcaggagcttgcggcaagagcg
gctaagcttggaggggagcttcatcaaggcatccaaacctacgcggttaccgatcatccg
gaatttggaaaaatttatgcatatgaaaccgacgggctaggcaattacaattttatggat
gacgcaaacgtaccaagccttctgtcgattccgtatctcggctatacctcgcaggaggat
ccgatttaccgcaatacgcgcgactttgtgctaagcagcagcaatccgtattacttcgaa
ggcgaagcggcagccggaatcggcagtccgcataccccggaccgttacatctggcacatc
gcgctggcgatgcagggcctgacaacggatgaccgtgccgagaaggaaagactgctcggc
ctgatggaagccacaacggcgggaaccggctttatgcacgaggggttccatgcggacgat
ccgtatcagttcagccgtccatggttctcgtgggccaacatgatgttcagcgagcttctg
cttgattattgcgggatacgagtacaaacgaaataa

DBGET integrated database retrieval system