KEGG   Paenibacillus sp. JDR-2: Pjdr2_5050Help
Entry
Pjdr2_5050        CDS       T00977                                 

Definition
(GenBank) transcriptional regulator, AraC family
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PocR HTH_18 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: ACT03661
JGI: Pjdr2_5050
UniProt: C6D133
Position
complement(5782592..5783617)
Genome map
AA seq 341 aa AA seqDB search
MNARYDLKQIMDIDKWHKLQDSMSLVTKMAIITVDYKGNPVSKHSECQAFCREVRKDSTL
SSYCQKCDARGGLEAVRSNKPYIYQCHFQILDIAIPIVVDNQYIGAVMAGQVKLSDPEVP
IEQIVTRPPNVETDKKFNALQEHYRSLPVLSFEEVEKIADMLFHLCNYIVEEAIRKSDML
QMYRDSLSRENPAAALVHTIDSSYEHIQALQSELSNTLIEKKLKNSASVYQAGNSILQPA
FDYIYRHKHVNADLKEMAALCHVSPSYFSRIFTKETGENFSVFVPHLKIGWAKELLETTD
LSVNQISDELGFADAGYFIKTFKKFESLTPAAYRKIYRDKA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaagatatgatctgaaacaaattatggatatcgacaaatggcacaagcttcag
gattccatgtctcttgtaacgaagatggcgatcattacggttgattacaagggtaacccc
gtttccaagcatagcgaatgccaggctttctgccgcgaggtgcggaaggactccacgtta
tcgtcctattgccagaaatgcgacgcgcgagggggactcgaggcggtccgttcgaacaag
ccttatatttatcaatgccattttcaaattctcgatatagcgattccgattgtggtggat
aatcaatatattggcgcggttatggcgggacaggtgaagctgagcgatcccgaagtgccg
attgagcagatcgtgacaaggcctcccaacgtggagacggataaaaagtttaacgctctg
caggagcattaccggtcgctgccggtgttgtctttcgaggaagtcgaaaaaatcgcagat
atgctgtttcatctgtgcaactatatcgtggaggaagcgatccgcaagagcgatatgctt
cagatgtaccgggactccttgtccagggaaaatccggccgctgctctcgtgcatacgatt
gattcctcttatgagcatattcaagcgctgcaaagcgagctgtccaatacgctgattgag
aaaaagctgaagaattccgccagcgtctaccaggcaggcaactctattttgcagccggct
tttgattatatttaccgccataagcacgtgaatgcggacctcaaggagatggctgcctta
tgccatgtcagtccgagttatttcagccggattttcaccaaggagacgggcgagaatttc
tcggtgtttgtcccgcatctgaagatcggctgggcgaaagagctgctcgagacaaccgat
ctgtccgtcaaccagatcagcgacgagctgggcttcgccgacgcgggttattttatcaag
acgttcaaaaagttcgagagccttacgccggccgcataccggaaaatctaccgggacaaa
gcctaa

DBGET integrated database retrieval system