KEGG   Paenibacillus sp. JDR-2: Pjdr2_5054Help
Entry
Pjdr2_5054        CDS       T00977                                 

Definition
(GenBank) hypothetical protein
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: pXO2-11
Motif
Other DBs
NCBI-ProteinID: ACT03665
JGI: Pjdr2_5054
UniProt: C6D137
Position
complement(5787932..5788093)
Genome map
AA seq 53 aa AA seqDB search
METFGRGCLWLIIGALGVLVLAVITQSTIHIPWFIFIPVVILVFWMASKKNKK
NT seq 162 nt NT seq  +upstreamnt  +downstreamnt
atggagacgtttggcagaggttgcctctggctcattattggcgctttaggcgtactggtg
ctcgccgtgattacccaaagcacgattcatattccttggtttatctttattcccgtcgtt
attctcgttttctggatggcttcaaagaaaaacaaaaaatga

DBGET integrated database retrieval system