KEGG   Paenibacillus sp. JDR-2: Pjdr2_5059Help
Entry
Pjdr2_5059        CDS       T00977                                 

Definition
(GenBank) sulfatase
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sulfatase Phosphodiest DUF229
Motif
Other DBs
NCBI-ProteinID: ACT03670
JGI: Pjdr2_5059
UniProt: C6D142
Position
5796014..5797492
Genome map
AA seq 492 aa AA seqDB search
MKAIIVMFDSLNRHMLPPYGGKDVHAPNFSRLAERSVTFDNNWVGSMPCMPARRDLLTGR
HNFLHRSWGPLEPFDDSLPALLRQQGVYSHLVSDHYHYWEAGGATYHNQYTTWDNVRGQE
GDPWKGVVANPDIPEHVHQYEGYRGWLFRQDWINRQYMSTETDHSQSQTFEKGLEFIRTN
RSEDRWLLQIEAFDPHEPFFAPQAYRDLYPHEYNGKPFDWPNYAKVQETRQEIEHCRFEY
SSLLSMCDASLGKVLDAMDEYDLWKDTMLIVTTDHGLLLGEHDWWGKSMMPFYNEIARTP
LFLWDPRSGDRGTRCGQLTQMIDLAPTLLELFGVPATPDMTGIPLTEALKAEAEGRRSRE
AALFGIHGAHVNCTDGQYVYMRAPVHPDNSPLYNYTLMPTHMASLFSVDELRGMELAEPF
PFTKGVSTLRIKADCFVPAHRMGTLLYDTVNDPDQLRPLDDNDAENRMKELLVSLMKASD
APSEQYERLGLS
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccataatcgtcatgttcgattcactaaaccgccatatgctgcctccctacggg
gggaaggatgttcacgcgcccaacttcagcaggcttgcggaaagaagcgtaaccttcgat
aacaactgggtaggcagcatgccctgcatgcccgcaagacgggatttgctcaccggccgt
cataacttcctgcatcgaagctggggaccgctggagccttttgacgattccctgcccgca
ttgctaaggcagcaaggggtctattcgcatttggtcagcgaccactatcattactgggag
gcaggcggcgcaacctaccataatcaatatacgacctgggataacgtgcgggggcaggaa
ggcgatccttggaaaggcgttgtcgccaatcccgatattccggagcatgttcatcaatat
gaagggtaccgcggatggctgttccggcaggattggattaaccggcaatatatgagcacg
gagaccgaccattcgcagtcgcagaccttcgagaaggggctggaatttatacgcactaac
cggagcgaagaccggtggctgctccagattgaagcctttgatccgcatgagccgtttttt
gcgccgcaagcttaccgggatctctatccccacgaatataacggcaagcccttcgactgg
cctaactatgccaaggtacaggaaaccagacaggaaatcgagcattgccgcttcgaatat
tcgtcgctgctcagcatgtgcgacgcttcgcttggcaaggtgctggacgcgatggacgaa
tatgatctgtggaaggataccatgctgatcgtcacgacggatcatggtctgctccttggc
gagcatgactggtggggcaaaagcatgatgcctttctataacgaaattgcccgcacgccg
ctgttcctatgggatccgcgctccggcgaccgcggcacgagatgcggccaattaacgcaa
atgattgatcttgccccaactctgctcgagctgttcggcgttccggcgacgccggatatg
accggcatcccgctgacggaggcgcttaaggcggaagccgaaggacggcgcagccgcgag
gccgcactattcggcatacatggcgctcacgtcaactgcaccgacgggcaatacgtttat
atgcgcgcacccgtgcatccggacaactcgccattatacaattacaccttaatgccgacg
catatggcctcgttgttctccgtcgacgagctgcgcggcatggagctagccgagcccttc
ccgtttacgaaaggcgttagcacgctccggattaaagcggattgttttgttcccgcccat
cgaatggggacgctgctttacgatacggtaaacgatccggatcaattgcggcccctggat
gacaatgacgccgagaataggatgaaggagctgctcgtgtcgcttatgaaagcaagcgat
gcgccgtccgagcaatatgaacgccttggcttgagctga

DBGET integrated database retrieval system