KEGG   Paenibacillus sp. JDR-2: Pjdr2_5069Help
Entry
Pjdr2_5069        CDS       T00977                                 

Definition
(GenBank) putative protein involved in invasion
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_oxidored FAD_binding_2 Pyr_redox_2 DAO GIDA FAD_binding_3 HI0933_like NAD_binding_8 Thi4 Trp_halogenase AlaDh_PNT_C Pyr_redox_3 Pyr_redox Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ACT03680
JGI: Pjdr2_5069
UniProt: C6D152
Position
complement(5811884..5813131)
Genome map
AA seq 415 aa AA seqDB search
MMTTYSFSREVETYKHADVVIIGGGPAGTAAAISAARCGKKVLLLEKTAQLGGMGTIANV
SVFMPIGNVTGIYRELISEMLAESLPAGHDESIAPQYSPFMLRHYLNEKMRKENVEVYFH
CEFVGTIQEGGTIKAVIVSTREGLRAFEGDCFIDCTGDARVAIDAGVPYTTGRETDGLTQ
PMTLMFTMQDTGKPVTPILPDGCYEYKEVSDLPQGRRLYWEQNKDGSLLVNMSRVKANGA
KIEDINYAETEALRQVFSIAYYLQKTGFENYALTHIAPQTGTRETNQIVGLYTLNEQDLT
SGARFQDVVAQTNYEIDIHSPDAQKTTDERKIDGYDIPYRCMVPAAFDNLLIAGRSISAT
HVAMSSMRVQATCYALGQAAGIAASLSIDDAATMQNIAMDKLHNILEDQGVKFKK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgatgactacttattctttttcgcgcgaggttgagacttacaagcatgcggatgttgtg
attatcggcgggggaccggcaggcacggctgccgccatcagcgcagcccgctgcggcaag
aaggttcttctgctggagaaaacggcgcagctcggcggcatggggacgatcgccaacgtt
agcgtatttatgccgatcggcaacgtaaccggcatttatcgcgagcttatatccgagatg
ctggctgaatctttgccggctggccatgatgaatccatcgcgccgcaatattcccctttt
atgctgcgtcattatttgaatgaaaagatgaggaaagagaacgttgaggtctacttccat
tgcgaatttgtagggacgatccaagagggcggtacaattaaggcggttatcgtgtccacc
cgcgagggattgagagcatttgaaggcgattgctttatcgattgtacgggggacgcgcgt
gtcgccatcgacgctggcgtgccttacacaaccgggcgggaaaccgatggactgacgcag
ccgatgacgctgatgtttacgatgcaggacacgggcaagccggtaacgcctattttgccg
gatggctgctacgaatacaaagaagtgtccgatctgcctcagggcagaagattgtattgg
gagcagaacaaggacggctcgctgctggtcaacatgtcgcgggtgaaagcgaacggtgcg
aagattgaagatatcaactatgccgagacggaagcgctccggcaggtgttttccattgct
tattatcttcagaagaccggctttgagaactacgcgcttacgcatatcgccccgcaaaca
ggaacgcgcgagacgaatcagatcgttggcctgtatacgctgaacgagcaggatctgacc
agcggagcgagattccaagatgttgtggcgcaaacgaattacgagattgatattcatagc
ccggacgcgcagaaaacaaccgatgaacgcaaaatcgacggctacgatatcccgtaccgc
tgcatggtgccagcagcattcgataacctgcttatagcgggccgttcgatttcggcgacg
catgtggccatgtcttcgatgcgcgtgcaggcgacctgttatgcgctggggcaggctgcg
gggattgcggcatcgctgtcgatcgacgacgcggcaacgatgcaaaatatagccatggac
aaactgcacaatatattggaagatcaaggtgtgaagtttaagaaataa

DBGET integrated database retrieval system