KEGG   Paenibacillus sp. JDR-2: Pjdr2_5089Help
Entry
Pjdr2_5089        CDS       T00977                                 

Definition
(GenBank) spore germination protein
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_permease
Motif
Other DBs
NCBI-ProteinID: ACT03700
JGI: Pjdr2_5089
UniProt: C6D172
Position
5841018..5842112
Genome map
AA seq 364 aa AA seqDB search
MQQRIKENYAISGYFVFFLIAVTQAAATIFNFQNLVLVNAGQDAWISIILIGVSLHLIIW
MIYKLLGNPAKDVIDVHQSIFGKYMGNALSFIVVGYYFLMALFFLRSYMEVIQVWVFPSL
RTWVIAGLFICIIYYVVSGGFRVVAGFSFFYLALIPMLFWLFFPARQGDLGLLLPVLNHS
FLDVIKSSKSSCIIFFGLEPLLIYLPFLKSAQKNAKWAHFALMFSTFKYAAIMIVTLMFF
SQGLLRHTLWPTMAMTQIIEFSFIARFEYVFIFMWQLIIIPTVCIPIWCCTRIMKRVCSV
KPGLSLPFVLAALLIAALTLKERTQIDAFGTFINKCAIYFHFAYIPLLFIITWIVARLKV
KHLE
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaacggataaaggaaaattacgcgatttccggatactttgtatttttcttaatt
gctgttacccaagctgccgcgactatatttaattttcagaaccttgtgctcgtgaatgcc
ggccaggatgcttggatatcgattattttgataggcgtgagccttcatctgatcatctgg
atgatctataaattgctcggcaatccggccaaagatgttattgacgtccatcaatcgatt
ttcggtaaatacatgggaaatgctctttctttcatcgttgttggttactatttcttaatg
gctctattctttctccgttcttacatggaagttattcaagtatgggtatttccttcgctt
cgcacatgggttattgcaggtttatttatctgcataatctactatgttgtttccggcggg
tttagggttgttgccgggttcagctttttttatttagcgctgattcccatgcttttctgg
ttgttttttccggcccgtcaaggggatctcggactattgctgcctgttctcaatcattct
tttctagatgtaataaaaagctcaaagtcatcctgcattattttctttgggcttgaacct
ctgcttatctatttgcctttcttgaaatctgcccaaaagaatgcaaagtgggcccatttc
gctctaatgttttcaacattcaaatatgccgcaatcatgattgtaaccctgatgtttttc
agtcaaggtcttctaagacataccttatggccaactatggctatgacgcaaatcattgag
ttttccttcatcgcaagattcgaatacgtctttatatttatgtggcagttgattattatt
ccaacggtttgtattcccatttggtgctgtacaagaattatgaaaagagtttgttcagta
aagcccgggctatctttaccttttgtgttggcagcgcttttgatcgctgcgttaaccttg
aaggaacggacacaaattgacgcatttggtacattcattaataaatgcgcgatttatttc
cattttgcttatattccgttgctgtttattatcacttggattgtagctcgcttaaaggta
aagcatcttgaatga

DBGET integrated database retrieval system