KEGG   Paenibacillus sp. JDR-2: Pjdr2_5236Help
Entry
Pjdr2_5236        CDS       T00977                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Pjdr2_5236
Enzymes [BR:pjd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Pjdr2_5236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6012617..6014431)
Genome map
AA seq 604 aa AA seqDB search
MSRLTWKDQKYRLDGEEFRILSGAIHYFRVVPEYWEDRLLKLKACGFNTVETYIPWNLHE
PREGSFRFDGFADVARFIETAGRLGLHVIVRPSPYICAEWEFGGLPAWLLKSSMGLRCMD
NEYLEKVDRYYDELIPRLLPLLDSRGGPIIAVQVENEYGSYGNDTAYLAYLRDGLIRRGV
DCLLFTSDGPTDEMLLGGTVEGLHATVNFGSRVAESLAKYREYRQDEPLMVMEYWLGWFD
HWRKPHHVREAGDVANVLDEMLEQGASVNLYMFHGGTNFGFYSGANYGEHYEPTITSYDY
DAPLTEWGDITEKYKAIRSVLEKHGIPEGAPFPAPIPKKAYGKVILTERGDLLDQLEQVS
AEQVQSVSIRPMEHYDQAYGFILYSTQVKGPRTRQKLHLREVRDRAQVFLDGKLIGVVER
WNPQPIEIAVPREGARLDVLVENMGRVNYGPYLRDHKGITEGILIDNQFQSNWTVTLLPL
ESEQLARVRYESVEVTGGQQHDGRPAFYRGFVEVDEPADTFLRFDGWQKGIAWINGFQLG
RYWEAGPQRALYVPGPLLRKGENEIVLFELHGVTGHPEVDLTDAPDLGETAAVDDQVLNF
VQEE
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
gtgagccggttaacatggaaggatcagaaatataggctggatggcgaggagttccggatt
ttgtcgggggcgattcattattttcgggttgtgccggaatattgggaggacaggctgctg
aagctgaaggcctgcggtttcaatacggtagagacgtatattccgtggaacctgcatgaa
ccccgcgagggaagcttccgcttcgacgggtttgcggatgtcgcccggttcatagagacg
gcgggccggcttggcctgcacgtgattgtccgtcccagcccttatatatgcgcggagtgg
gagtttggcggcttgccggcctggctgctgaaatcgtccatgggcttgcgctgcatggat
aatgaatacctggaaaaagtcgaccgctactatgacgagcttattccgcgcctgctgccg
ctgctggattcgcggggcggtccgatcattgcggtgcaggtcgagaatgaatacggcagc
tacggcaatgacaccgcgtatttggcttacttgagggatggcctgatccgacgcggagtt
gactgtctgctgttcacctcggacggcccaacggacgagatgctgctgggcggcacggta
gaggggctgcatgcaacagttaacttcggttcgcgcgtagcggagtccctcgcgaaatac
cgggagtatagacaggacgaaccgctgatggtgatggagtactggcttggctggttcgac
cattggcggaagccgcatcatgtccgggaggcgggggatgtcgctaacgtattggatgag
atgctggagcaaggggcatccgtgaatctctacatgttccacggcgggacaaacttcggc
ttttacagcggagccaactacggtgagcattatgaaccaacgataacaagctatgattat
gatgcgcctcttacggagtggggggatataaccgagaaatacaaagctatccgaagcgtg
ctcgaaaagcacggcataccggaaggagcgccgttcccggctccgattccgaagaaagct
tacggcaaggttattttaacggaacggggcgatttgctggatcagctcgagcaggtatcc
gccgaacaggtgcaatccgtcagcatccggccgatggagcattacgatcaggcttacggc
tttattttgtactcgacccaggttaaggggccaagaacgagacaaaagcttcatcttcgc
gaggtgcgcgatcgcgctcaggtattcctggacggcaagctgatcggcgttgttgagcgg
tggaatccgcagccgattgagatcgcggttcccagagaaggggcaagattggatgtcctg
gtcgaaaatatgggccgcgttaattacggcccttatctgcgcgatcataaaggaataacg
gaaggtatcctgatcgataaccagttccagtcgaactggacggttaccctgctgccgctt
gagtccgagcagctcgctcgggtccgctatgagtctgtggaagtaacagggggacagcag
catgacgggcgtcctgccttctatcgtggatttgtggaggtggatgaacctgccgatacg
ttcctccggtttgacggctggcagaaggggattgcctggatcaacggcttccagcttggc
cgctattgggaagcgggaccgcagcgcgcgttatacgtgccgggtccgctgctgcgcaaa
ggggaaaacgaaattgttttattcgagctgcatggcgtaaccggacatcccgaagtggat
ttaaccgatgctcccgaccttggcgagacggctgcggttgacgaccaggtgctaaacttc
gtacaggaagaatag

DBGET integrated database retrieval system