KEGG   Paenibacillus sp. JDR-2: Pjdr2_5337Help
Entry
Pjdr2_5337        CDS       T00977                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Pjdr2_5337
Enzymes [BR:pjd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Pjdr2_5337
Exosome [BR:pjd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pjdr2_5337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6133189..6134685)
Genome map
AA seq 498 aa AA seqDB search
MTQQETYIIALDQGTTSTRAILFDKAGNPRAVAQTAVDCTFPHPGWVEQDAEQLWETSLK
VIRELLAKEGLEADRIAAIGISNQRETTIIWDKMTGKPVYNAVVWQSRQTSGICEALKEA
GHEMPIREKTGLLIDPYFSGTKAKWVLNEVTGAREKAAAGELLFGTVDSWLIWKLTGGAV
HVTDYSNASRTLLYNIHELKWDADLLEWLDIPASMLPEVRSSSEVYGETEAALFGGPIAI
AGAAGDQQAALFGHGCFEKGEAKNTYGTGCFMLMNTGTEPIRSEHGLLTTIAWGLDGQVE
YALEGSVFVAGSAVQWLRDGMELIESSEESEKLASAVDSTEGVYVVPAFVGLGTPYWDSE
VRGAVFGMTRGTRREHFVRATLESIAYQTKDVLDAMEQSAGIPLQTLCVDGGAIRNNLLM
QFQSDLLGVPVERPVISETTALGAAYLAGLAVGYWQGRGEILEQRRLDLVFEPAMAQERV
DQLYAGWQKAVKAAMAFR
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcaggaaacctatatcatcgcgctggaccaaggaacaacgagcacacgtgcg
attttattcgataaagcggggaacccgcgcgcggttgcccagacggcggtggactgcacg
ttcccgcatccgggctgggtagagcaggacgccgagcagctgtgggaaacctcgctgaag
gtaattcgcgagctgcttgcgaaggaaggcttggaggcggatcgcatcgccgcgatcggt
atctccaatcagcgggagacgacgataatctgggacaaaatgacggggaagcccgtctat
aacgccgtcgtctggcaatcgcgccagacttcgggcatttgcgaagccttgaaggaagca
ggacatgagatgccgatccgggagaaaacagggctcctgatcgacccctatttctccgga
acaaaggcgaaatgggtgcttaacgaggtaacgggagcgcgtgaaaaagccgcggccggc
gagttgttattcggcaccgtggacagctggctgatctggaagctgaccggcggagcggtt
cacgtgacggactattcgaatgcgtcgcggacgctgctgtacaacatccatgagctgaag
tgggatgccgacctgctcgaatggctggacattccggcttccatgctgccggaggtgcgc
tcttcttccgaggtgtacggcgaaacggaagcggcgctgtttggcgggcctattgctatc
gcgggcgcggcgggcgaccagcaggccgctttgtttgggcatggatgctttgaaaagggc
gaagcgaaaaacacgtacggcaccggctgttttatgctgatgaacaccggcacggagccg
atccgttcggagcatggcctgcttacgaccattgcctggggcttagacggacaggtggaa
tacgcgcttgaaggcagcgtctttgtagccggttcggcggtacagtggcttcgcgacggc
atggaattaatcgagtcctcggaggagagcgaaaagctggcttctgccgtggattcgacg
gaaggcgtttacgttgttccggcctttgtcggactagggacgccttattgggacagcgag
gtccgcggcgcggtattcggcatgacgcgcgggacgcggcgcgagcattttgtccgggca
acgcttgagtcgattgcgtatcagacgaaggatgtgctggacgcgatggagcagtcggcg
ggcattccgctgcaaacgctatgcgtggacggcggcgcgatccgcaacaatttgctcatg
cagttccagagcgatctgcttggcgtgccggtcgaacggccggtcatcagtgagacaaca
gcgcttggcgccgcttatttggcggggcttgcggttggctattggcagggccgcggggag
attctggagcagcggcggctggaccttgtttttgagccggcgatggcacaggaacgggtg
gatcagctgtatgccggttggcaaaaggcggtaaaggcggcaatggcttttcgataa

DBGET integrated database retrieval system