KEGG   Paenibacillus sp. JDR-2: Pjdr2_5365Help
Entry
Pjdr2_5365        CDS       T00977                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00260  Glycine, serine and threonine metabolism
pjd00750  Vitamin B6 metabolism
pjd01100  Metabolic pathways
pjd01110  Biosynthesis of secondary metabolites
pjd01120  Microbial metabolism in diverse environments
pjd01230  Biosynthesis of amino acids
Module
pjd_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pjdr2_5365
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pjdr2_5365
Enzymes [BR:pjd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pjdr2_5365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP DUF2997
Motif
Other DBs
NCBI-ProteinID: ACT03975
JGI: Pjdr2_5365
UniProt: C6D2P7
Position
complement(6161764..6163164)
Genome map
AA seq 466 aa AA seqDB search
MEYISTRGNVGKIGFVDAFLMGLADDGGLLVPYEIPVVSAAKLKEWQELSYQELVLEIFS
LYTNDEIPYEDLKKMVYDGYATFRHPEVTPVHKLKDDLYLLELFHGPTFAFKDIALQFMG
QLYTYVSRKQNKKIHILGATSGDTGASAIEGVKGKEGIKICILHPNGKVSKVQELQMTTI
LDDNVLNLSVEGNFDDCQRIIKDLFADLEFKAANHLCAINSINFVRIMAQTVYYFYSYFQ
VAKQTGKQDAKVNFSVPTGNFGDIFAGYLAKRMGLPVDKLILATNENNILERFIKEGVYK
PGDFRTTYSPSMDIQVASNFERYLYYVLDENPEQIRSIMDGFKSEGQIVVSGDALRKVQE
EFAAHGVEGRECLDTIAAYNKETGYLLDPHSACGVAASDQQAAAGSVTISLATAHPAKFN
EAIELIGIEQEFPAQIQALFNKPQRQTQVDGTQEAIVQEIVKFYNA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggaatatatcagtactcgcggaaatgtaggcaaaatcggctttgtcgacgctttcctc
atgggtcttgcggacgacggcggccttcttgtgccttacgaaattccggttgtttccgcg
gctaagctgaaagaatggcaggagctcagctatcaggagctggtgcttgaaattttctcg
ctttatacgaatgatgaaattccttatgaagatctgaagaaaatggtatacgacggctac
gcgacgttccgccatccggaagttactccggttcataagctgaaggatgacctctatttg
ctggaattgttccatggtcctacttttgcattcaaggacattgcgctccagttcatgggc
caattatatacgtacgtgtcccgcaagcagaataagaagatccacattcttggcgctacc
tccggcgacacaggcgcttcggcgatcgaaggcgtcaaaggcaaagaaggcatcaagatc
tgcatcctgcatccgaacggcaaagtaagcaaagtgcaggagctgcagatgacgacgatt
ctagatgacaatgttctgaacctgtccgtggaaggcaacttcgacgactgccaacgcatc
attaaagacctgttcgctgatctggagttcaaagcggctaaccatctgtgcgcgattaac
tcgatcaacttcgtacgcattatggcgcaaacggtctactacttctattcgtacttccaa
gtggcgaagcagacaggcaagcaagacgcaaaagtgaacttcagcgtgccgacaggcaac
tttggcgatatttttgcgggatacctggcgaagcgtatggggctgccggttgacaagctt
attctcgctacgaacgaaaacaacatccttgagcgcttcatcaaagaaggcgtgtacaag
ccgggcgatttccgcacgacttacagcccatcgatggacattcaagtggcaagcaacttc
gaacgttacctttactatgtattggacgaaaatcctgagcaaatccgttcgattatggac
ggctttaagtcggaaggtcaaatcgtcgtatccggcgacgcgctccgcaaagtacaggaa
gagttcgctgcgcatggcgtagaaggccgcgagtgtctggacacgattgcagcatacaat
aaagaaacgggctacctgctggatcctcactccgcatgcggcgtagcggcatcggaccaa
caagcggcagcaggctcggtaacgatctcgctggcaacggcgcatcctgcgaagttcaac
gaagcgattgagctcattggcattgagcaagagttccctgcgcaaattcaggcgcttttc
aacaagccgcagcgtcaaacgcaggtggacggcacgcaagaagcaatcgttcaagaaatc
gtgaagttctacaacgcgtaa

DBGET integrated database retrieval system