KEGG   Paenibacillus sp. JDR-2: Pjdr2_5454Help
Entry
Pjdr2_5454        CDS       T00977                                 

Definition
(GenBank) glycoside hydrolase clan GH-D
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00052  Galactose metabolism
pjd00561  Glycerolipid metabolism
pjd00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Pjdr2_5454
  Lipid metabolism
   00561 Glycerolipid metabolism
    Pjdr2_5454
   00600 Sphingolipid metabolism
    Pjdr2_5454
Enzymes [BR:pjd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Pjdr2_5454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C GHL10 Glyco_hydro_31 Melibiase_2 Peptidase_C54
Motif
Other DBs
NCBI-ProteinID: ACT04064
JGI: Pjdr2_5454
UniProt: C6D3B7
Position
complement(6250932..6253124)
Genome map
AA seq 730 aa AA seqDB search
MAIIFDQESRVFHLQSKNTSYAFQILKQGYPAHIYWGKKVRGLQLNRLLQIKERASFSPN
PDQNQLDLSLDALPQEYPSYGATDFRSPAYQVKLPNGSTILELTYQSHEIYSGKKKLEGL
PAVYVESDSEAQTLELTLKDDLTGLTAVLSYTVFEDLDAITRSVKFVNSGEMTLDLQRAL
SMSVDFVHDRFEMLQLSGAWARERYVHKRKLEPGMQSVESRRGSSSHMQNPFLALLSEGA
TEDHGDVYGVNLVYSGSFIAGVEVDQYHSSRLFIGINPFDFNWKLEAGAQFQTPEAVMVF
SPDGLGGMSRIYHELYRTRLVRGEFRDKTRPILVNNWEATYFNFNADKIGAIATAGKELG
IEMFVLDDGWFGKRNADTTSLGDWFVDRNKLPNGLEDLVARVKRLDMQFGLWFEPEMISP
ESELYKAHPDWCLHVEGRRRSQGRNQLILDFSRQDVRDYIVKTVSDILSSAPITYVKWDM
NRNMTEIGSALLPADRQRETAHRYMLGLYEVLETITTSFPHILFESCSGGGGRFDPGMLY
YMPQTWTSDNTDAVSRLKIQYGTSIVYPISTMGAHVSAIPNHQVGRKASLETRGNVALSG
NFGYELDLTVFTEEEKEAVKKQVALYKEVRPLVQFGDFYRLLSPFEGNETAWMFVSKDKS
EAFVVYVSVLQEANQKLDRLRLKGLDPNFDYVLDGEEGAFGGDELMHAGIQAPLFHGDYS
SKVFRFRAVK
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggctattattttcgatcaggaatcccgcgtatttcatctgcaatccaagaacacaagc
tacgcgtttcaaattttgaagcagggttatcccgctcacatttattggggcaagaaggta
agaggcctgcagcttaaccgtcttctccaaatcaaagaaagagcttcgttcagcccgaat
ccggaccaaaaccagctggatctgtcgctcgatgctttgccgcaggaatatccttcctat
ggagcaaccgatttccgttcgccggcctaccaagtgaagctgcctaacggctcgacgatt
ctggaattgacttatcaatcccatgaaatctacagcgggaagaagaagctcgaaggcctg
ccggctgtttatgtcgagtcggactcggaagcacagacgcttgagctgactctgaaggat
gacctgaccggtcttacggcggtattgtcctataccgtattcgaggatcttgacgcgatt
acgcgttccgtgaaattcgttaatagcggcgagatgacgctggatctgcagcgcgcgctt
agcatgagcgttgattttgtccatgaccgtttcgaaatgctgcaattgtccggcgcatgg
gcgcgcgagcgttacgtgcacaagcggaagcttgagccaggcatgcaatccgtcgagagc
cgccgcggttcctccagccatatgcaaaatccgttcctcgccttgctcagcgaaggcgca
accgaggatcatggcgatgtttacggcgttaaccttgtgtacagcggcagctttattgcg
ggtgttgaagtcgatcaataccattcgtctcgtttgtttatcggcattaatccattcgac
ttcaactggaagctggaagccggagcgcagttccaaacgccggaagcggttatggtgttc
tcgcctgacggacttggcggcatgtcccgcatttaccacgagctttatcgcacaagactg
gttcgcggggagttccgcgacaagacccgtccaattctcgtcaacaactgggaagcgacg
tacttcaacttcaacgcggacaaaatcggagcgatcgctacagcgggcaaagagcttggc
atcgaaatgtttgttctcgacgacggctggttcggcaaacggaacgcggacacaacatcg
cttggcgactggtttgttgaccgtaacaagctgccgaacggactcgaggatctggttgcg
cgggtaaaacgcctggatatgcagtttggcctgtggtttgagccggagatgatctcgccg
gagagcgagctgtacaaggcgcatccggactggtgcctccatgtggaaggccgccgcaga
tcgcaaggccgcaatcaactcattctggacttctcccgtcaggatgttagagactacatc
gtgaagaccgtatcggatatcctgtcgagcgcgccaatcacttacgtgaaatgggacatg
aaccgcaacatgacggagatcggttccgctctcctgccggctgaccgccagcgcgagacg
gctcaccgctacatgctgggactgtatgaagtgctcgagacgattacgacatcgttccct
catattctgttcgagagctgctcgggcggcggcggacgtttcgatccgggcatgctgtac
tacatgccgcaaacctggaccagcgataacaccgatgcggtatcccgtctgaaaatccag
tacggcacaagcatcgtttatccgatcagcacgatgggcgcccatgtatcggcgattccg
aaccatcaggttggccgtaaagcctcccttgaaactcgcggcaacgtagctttgtcgggc
aacttcggctatgagctggacctcaccgtgtttacggaagaagaaaaagaagccgtgaag
aagcaggttgccctgtacaaagaggttcgtcctttggtgcaattcggcgacttctaccgt
ctgcttagcccgtttgagggcaatgaaacggcttggatgtttgtctccaaagacaagagc
gaagcgtttgtcgtttacgtgtccgttcttcaagaggctaatcagaagctggaccgcctc
cgcctgaaagggcttgatccgaacttcgactatgtactcgacggagaagaaggcgcattt
ggcggcgacgagctgatgcatgccggcattcaggcacctctgttccatggcgattattcg
agcaaggtattccgcttccgcgcggtaaaataa

DBGET integrated database retrieval system