KEGG   Paenibacillus sp. JDR-2: Pjdr2_5806Help
Entry
Pjdr2_5806        CDS       T00977                                 

Definition
NADH dehydrogenase subunit K
Orthology
K00340  
NADH-quinone oxidoreductase subunit K [EC:1.6.5.3]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Oxidative phosphorylation
Metabolic pathways
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:pjd00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6664701..6665003)
Genome map
AA seq 100 aa AA seqDB search
MLPSYLTMAAILFCIGLYGALVKRNAVIVLLSIELMLNAVNLNLVAFSKYGVVPSLTGQV
FALFAITVAAAEAAVGVAVLIALFRARGTVNVDEFDEMKR
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgcttccatcttatctgacgatggcggcgatcctgttttgcatcggactgtatggagct
ttggtgaaacggaatgccgtgatcgtcctgttatcgattgagctaatgctgaacgcggtg
aatctgaatttggtcgcgttctccaaatacggggttgtcccgtccctaaccggccaggta
ttcgctttgtttgccattacggtggcggcggcggaggctgccgttggggtggcggtgctg
atcgccctgttccgcgcgcgaggtaccgttaatgtagatgaattcgacgagatgaagagg
tga

DBGET integrated database retrieval system